DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15170 and CG4377

Sequence 1:NP_609927.1 Gene:CG15170 FlyBaseID:FBgn0032733 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_611614.1 Gene:CG4377 FlyBaseID:FBgn0034664 Length:231 Species:Drosophila melanogaster

Alignment Length:233 Identity:60/234 (26%)
Similarity:84/234 (36%) Gaps:54/234 (23%)


  Fly   342 NSKDFTRCYQCSTDQAGAGCANWESPGEIYIEECDEPAAPCVVVSFNNATTARGCQKSDFS---- 402
            ||.:..:||.|.    |..|:  .:..:.....|.:....||.:..:.|.:.|||    ||    
  Fly    30 NSAESPKCYSCE----GINCS--RTTRQNATVSCSDRLDVCVTIYEDFAVSERGC----FSQISL 84

  Fly   403 -----CASANVASCRLCEGSFCNKGSFPEERLWCHQCRGVQDCEEISRGQTAMPCPARANEPEDQ 462
                 || |....|:.|.|..||  :.......|.||.| .|..:.::|.||.....:...|...
  Fly    85 AGQAKCA-AKDDQCQKCSGQLCN--NVGRRDFKCIQCIG-SDSADCNKGATASLAATQCALPTSA 145

  Fly   463 ELACLEYFDI---NSKEIVRGCRSNPELYYECLLRSNHFDSCRTC------HSQACNNSPGRELR 518
            ...|  |..:   ....:.|||..:.:....||..|    .|..|      .|.||||       
  Fly   146 NSYC--YVKVVGDQKDSLQRGCALSVKEQKACLEDS----KCSLCLPENSSDSVACNN------- 197

  Fly   519 ASYELEAKALSLLQGKSSA-ISIKFSNAGYGVWLIFSV 555
              |:||      |..|||| .|.|..:.|...:.:.|:
  Fly   198 --YDLE------LGPKSSAEQSKKLLSYGLAFFALLSL 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15170NP_609927.1 DUF753 35..166 CDD:283175
DUF753 278..416 CDD:283175 21/83 (25%)
DUF753 351..506 CDD:283175 39/173 (23%)
CG4377NP_611614.1 DUF753 36..184 CDD:283175 40/168 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131028566
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.