DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15170 and CG13492

Sequence 1:NP_609927.1 Gene:CG15170 FlyBaseID:FBgn0032733 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_726121.3 Gene:CG13492 FlyBaseID:FBgn0034662 Length:2979 Species:Drosophila melanogaster

Alignment Length:743 Identity:155/744 (21%)
Similarity:227/744 (31%) Gaps:292/744 (39%)


  Fly    11 SFHHLLLLFLVLLRSDRC--FGIV-----CYHCDSIALPECS------QTLGEVGVLPYKECATE 62
            :||.||     ....:.|  |.|:     |..|||...|.|:      ..:|..|||||..|.|.
  Fly   674 NFHSLL-----FCDDNDCNFFDILPTPHECIVCDSSEDPNCATDPSKITLIGNCGVLPYTSCQTR 733

  Fly    63 LTCAMSIVDSITYRGC-------GAETPIIGATYSKTCSTNLCNAGVYPPGRLKCHHC---AGQE 117
                  |:...|.|.|       ..:..:.|......|:.:.||:.:||..|.:||.|   ....
  Fly   734 ------IISGRTQRSCLSSLEREQLQECLDGTGNCVVCTGDRCNSEIYPADRRRCHRCNSVTDPT 792

  Fly   118 CVAAPASKPKPCRYHLEEDQCYTDVISSSDAYRGC------------------------------ 152
            |.:|| ...:.|.|:||::.|...:: ..:.||||                              
  Fly   793 CSSAP-DAAEVCPYYLEDEGCSAKLV-DGETYRGCQREFTCDDSDKQHCRLCSGKDNCNVADLFN 855

  Fly   153 -------------------------------------TSEQN-----------------HTLSTS 163
                                                 ..|||                 .||...
  Fly   856 SYIGYPSKWLTPPVNCYTCNGTDCQGDSSGTLRKCTGNDEQNCGTVFDASGSVIFRGCSDTLYED 920

  Fly   164 AQL-------------CEINGCNEEQGAWTQV-CATCDSA------------------------- 189
            |:|             |:.:|||..:...|.| |..||.:                         
  Fly   921 AELLQYCDENSANCKFCKSSGCNNAKELSTYVDCLFCDGSDEAECVRKVGDITRTVSCQGSCLTG 985

  Fly   190 --------------IGRGCKIDLFQVNTGRCNVSLYEEC---------QQDVLLGEQEDK----- 226
                          :.|||..||...:...|:....|.|         :.||    .||:     
  Fly   986 LYPRNRSEANPVYDLARGCLDDLDYDDREACSAGTLENCVSCSSATCNKADV----PEDRLSCNV 1046

  Fly   227 ------------YCFSFRR----------LSRVVRGCSTKIPTDL------EPYVEQLEKCNTSD 263
                        .|..:|.          ||....||:|.:....      :.|:...:.|||.|
  Fly  1047 CEDDACETLTSQLCLGYRSGDQCYIHVGDLSIKAMGCATDLQDSFLLTNRRDLYLCSGDDCNTKD 1111

  Fly   264 HCNAGCITQQKCFTCNSVDQELCRTNITAIANSTCSSAEASSCFSCEYSNWSIQRGCGAPPENPQ 328
            ..|...::   |..|||...:.|....:|:| :.|.......|:|....:..:.|||.|...:..
  Fly  1112 KLNLNGVS---CNVCNSTYDDGCVGGNSALA-TVCEHYINPECYSYLNEDGVLLRGCLADTNDEL 1172

  Fly   329 ITKCYECDEGAGCNSKDFTRCYQCSTDQAGAGC--ANWESPGEIYIEECDEPA-APCV------- 383
            .      ||   |:|...|.|..|||:......  :||     :....||..: |.|.       
  Fly  1173 F------DE---CSSDGSTNCTICSTNNCNNDVYPSNW-----LTCLRCDSASDADCALNPASYS 1223

  Fly   384 ------------VVSFNNATTARGCQKSDFSCASANVASCRLCEGSFCN-----------KGSFP 425
                        |.|.:|..|.|||| |:.:|.::...|||:|..:.||           .|.:.
  Fly  1224 SYCRTYSEDDACVTSLSNGRTRRGCQ-SELNCDASQAGSCRVCSEANCNTVDLQSSYVGEPGKWT 1287

  Fly   426 EERLWCHQCRGVQDCEEISRGQTAMPCPARANEPEDQELACLEYFDINSKEIVRGCRSNPELYYE 490
            :..|.||.|.....|..:  |.....|..      :.:..|...|:...:.:.|||.       :
  Fly  1288 DLPLSCHVCSDAASCATV--GTEITKCEG------NNKQTCSTVFNSEGQVVARGCS-------D 1337

  Fly   491 CLLRSN------HFDSCRTCHSQACNNS 512
            .:|.:|      :.|.|..|.|..|||:
  Fly  1338 AVLAANVDYCDLNGDKCVQCKSDGCNNA 1365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15170NP_609927.1 DUF753 35..166 CDD:283175 45/231 (19%)
DUF753 278..416 CDD:283175 42/160 (26%)
DUF753 351..506 CDD:283175 43/194 (22%)
CG13492NP_726121.3 DUF753 112..263 CDD:283175
DUF753 281..428 CDD:283175
DUF753 368..520 CDD:283175
DUF753 537..674 CDD:283175 155/744 (21%)
DUF753 700..844 CDD:283175 39/152 (26%)
DUF753 871..>965 CDD:283175 16/94 (17%)
DUF753 956..1104 CDD:283175 22/152 (14%)
DUF753 1122..1266 CDD:283175 42/160 (26%)
DUF753 1206..1336 CDD:283175 33/139 (24%)
DUF753 1376..1523 CDD:283175
DUF753 1540..1690 CDD:283175
DUF753 1721..>1811 CDD:283175
DUF753 1797..1948 CDD:283175
DUF753 1966..2110 CDD:283175
DUF753 2051..2191 CDD:283175
DUF753 2220..2368 CDD:283175
DUF753 2384..2530 CDD:283175
DUF753 2640..2769 CDD:283175
DUF753 2801..2943 CDD:283175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131028633
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.