DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Swip-1 and EFHD2

Sequence 1:NP_001286079.1 Gene:Swip-1 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_077305.2 Gene:EFHD2 HGNCID:28670 Length:240 Species:Homo sapiens

Alignment Length:212 Identity:112/213 (53%)
Similarity:146/213 (69%) Gaps:2/213 (1%)


  Fly     6 NASSASNKDSVDSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQ 70
            |.::|:...:.|..:....:...||:..|.||.::  :|..|.....:.:|.|.||:|.||||.|
Human    31 NGAAAAAAGAPDEAAEALGSADCELSAKLLRRADL--NQGIGEPQSPSRRVFNPYTEFKEFSRKQ 93

  Fly    71 IKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFR 135
            |||.:|.|..||..||||:||.|||.|||||||||||||||.||.|||||.|.|:||||||||||
Human    94 IKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFR 158

  Fly   136 KAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEE 200
            ||.||||..||||..||||:|:||...||.|||:|||||::....:::|.:||:||||||:::.|
Human   159 KAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAE 223

  Fly   201 ERAQRRQQFQQRAAIFQ 217
            |..||:..|::..:.|:
Human   224 EMKQRKAAFKELQSTFK 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 43/58 (74%)
EF-hand_7 75..131 CDD:290234 42/56 (75%)
EFHD2NP_077305.2 EFh 96..154 CDD:238008 43/58 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280417972
eggNOG 1 0.900 E1_KOG0041
Hieranoid 1 1.000
Homologene 1 1.000 H32580
Inparanoid 1 1.050 215 1.000 Inparanoid score I3564
Isobase 1 0.950 0 Normalized mean entropy S3918
OMA 1 1.010
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 1 1.000 FOG0002504
OrthoInspector 1 1.000 T609822
orthoMCL 1 0.900 OOG5_131843
Panther 1 1.100 O PTHR13025
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R10220
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.