DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Swip-1 and efhd2

Sequence 1:NP_001286079.1 Gene:Swip-1 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001313422.1 Gene:efhd2 ZFINID:ZDB-GENE-060531-152 Length:233 Species:Danio rerio

Alignment Length:201 Identity:114/202 (56%)
Similarity:144/202 (71%) Gaps:4/202 (2%)


  Fly    17 DSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTY 81
            |.|  ||::..|||...|.||.|:.|.  .|...:.:.||.|.||:|.||||.||||.:|.|..|
Zfish    37 DKP--TTSSADSELGAKLQRRGELNEG--VGEHQQPSMKVFNPYTEFKEFSRKQIKDMEKMFKQY 97

  Fly    82 DTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDS 146
            |:.:|.::||.|||.|||||||||||||||.||.|||||.|||:||||||||||||.||||..||
Zfish    98 DSEKDNYIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDLDGKLSFREFLLIFRKAAAGELAEDS 162

  Fly   147 GLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQQFQQ 211
            ||:.||||:|:||...||.|||:|||||::....:|:|..|||.||||::::.||:.||:..|::
Zfish   163 GLHVLARLSEIDVSTEGVKGAKSFFEAKVQAINESNRFEAEIRLEQEEKKKQAEEKKQRQAAFKE 227

  Fly   212 RAAIFQ 217
            ..:.|:
Zfish   228 LKSAFK 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 41/58 (71%)
EF-hand_7 75..131 CDD:290234 40/56 (71%)
efhd2NP_001313422.1 EFh 89..147 CDD:238008 41/58 (71%)
EF-hand_7 90..147 CDD:290234 40/57 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280424456
eggNOG 1 0.900 E1_KOG0041
Hieranoid 1 1.000
Homologene 1 1.000 H32580
Inparanoid 1 1.050 215 1.000 Inparanoid score I3530
OMA 1 1.010
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 1 1.000 FOG0002504
OrthoInspector 1 1.000 T597505
orthoMCL 1 0.900 OOG5_131843
Panther 1 1.100 O PTHR13025
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R10220
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.