DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and efhd2

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001313422.1 Gene:efhd2 / 571114 ZFINID:ZDB-GENE-060531-152 Length:233 Species:Danio rerio


Alignment Length:201 Identity:114/201 - (56%)
Similarity:144/201 - (71%) Gaps:4/201 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTY 81
            |.|  ||::..|||...|.||.|:.|.  .|...:.:.||.|.||:|.||||.||||.:|.|..|
Zfish    37 DKP--TTSSADSELGAKLQRRGELNEG--VGEHQQPSMKVFNPYTEFKEFSRKQIKDMEKMFKQY 97

  Fly    82 DTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDS 146
            |:.:|.::||.|||.|||||||||||||||.||.|||||.|||:||||||||||||.||||..||
Zfish    98 DSEKDNYIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDLDGKLSFREFLLIFRKAAAGELAEDS 162

  Fly   147 GLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQQFQQ 211
            ||:.||||:|:||...||.|||:|||||::....:|:|..|||.||||::::.||:.||:..|::
Zfish   163 GLHVLARLSEIDVSTEGVKGAKSFFEAKVQAINESNRFEAEIRLEQEEKKKQAEEKKQRQAAFKE 227

  Fly   212 RAAIFQ 217
            ..:.|:
Zfish   228 LKSAFK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 40/57 (70%)
efhd2NP_001313422.1 EFh 89..147 CDD:238008 40/57 (70%)
EF-hand_7 90..147 CDD:290234 39/56 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580520
Domainoid 1 1.000 94 1.000 Domainoid score I7431
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32580
Inparanoid 1 1.050 215 1.000 Inparanoid score I3596
OMA 1 1.010 - - QHG52325
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - otm25375
orthoMCL 1 0.900 - - OOG6_105725
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10220
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.