DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Swip-1 and Efhd1

Sequence 1:NP_001286079.1 Gene:Swip-1 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001102780.1 Gene:Efhd1 RGDID:1559565 Length:240 Species:Rattus norvegicus

Alignment Length:199 Identity:112/200 (56%)
Similarity:140/200 (70%) Gaps:5/200 (3%)


  Fly    18 SPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTYD 82
            :|:.|.:.| |||...|:.|..|   .:..:..||: ||.|.||:||||||..:||.::.|.|||
  Rat    45 APAPTVSAD-SELNLKLSSRLNI---HQGAVRSRRS-KVFNPYTEFPEFSRRLLKDLERMFKTYD 104

  Fly    83 TARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDSG 147
            ..:|||:||.|||.|||||||||||||||.||.|||||.|||:|||||||||.||.||||..|||
  Rat   105 AGKDGFIDLMELKLMMEKLGAPQTHLGLKNMIQEVDEDFDGKLSFREFLLIFHKAAAGELQEDSG 169

  Fly   148 LNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQQFQQR 212
            |..||:.:|::|...||.|||||||||.:....::||..|::|||:||:||||.|..|:..|::.
  Rat   170 LLALAKFSEINVALEGVRGAKNFFEAKAQALACSSKFEAELKAEQDERKREEEARRLRQAAFREL 234

  Fly   213 AAIF 216
            .|.|
  Rat   235 KAAF 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 43/58 (74%)
EF-hand_7 75..131 CDD:290234 42/56 (75%)
Efhd1NP_001102780.1 EFh 95..153 CDD:238008 43/58 (74%)
EF-hand_7 96..153 CDD:290234 42/57 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280423194
eggNOG 1 0.900 E1_KOG0041
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3483
OMA 1 1.010
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 1 1.000 FOG0002504
OrthoInspector 1 1.000 T618753
orthoMCL 1 0.900 OOG5_131843
Panther 1 1.100 LDO PTHR13025
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.