DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Swip-1 and Efhd2

Sequence 1:NP_001286079.1 Gene:Swip-1 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001026818.1 Gene:Efhd2 RGDID:1307585 Length:239 Species:Rattus norvegicus

Alignment Length:212 Identity:112/213 (53%)
Similarity:148/213 (69%) Gaps:2/213 (1%)


  Fly     6 NASSASNKDSVDSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQ 70
            |.::|:..::.|..:....:...||:..|.||.::  :|..|.....:.:|.|.||:|.||||.|
  Rat    30 NGAAAAAAEAPDETAQALGSADDELSAKLLRRADL--NQGIGEPQSPSRRVFNPYTEFKEFSRKQ 92

  Fly    71 IKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFR 135
            |||.:|.|..||..:|||:||.|||.|||||||||||||||.||.|||||.|.|:||||||||||
  Rat    93 IKDMEKMFKQYDAGKDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFR 157

  Fly   136 KAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEE 200
            ||.||||..||||:.||||:|:||...||.|||||||||::....:::|.:||:||||||:::.|
  Rat   158 KAAAGELQEDSGLHVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAE 222

  Fly   201 ERAQRRQQFQQRAAIFQ 217
            |..||:..|::..:.|:
  Rat   223 EVKQRKAAFKELQSTFK 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 42/58 (72%)
EF-hand_7 75..131 CDD:290234 41/56 (73%)
Efhd2NP_001026818.1 EFh 95..153 CDD:238008 42/58 (72%)
EF-hand_7 96..153 CDD:290234 41/57 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280417400
eggNOG 1 0.900 E1_KOG0041
Hieranoid 1 1.000
Homologene 1 1.000 H32580
Inparanoid 1 1.050 215 1.000 Inparanoid score I3483
OMA 1 1.010
OrthoDB 1 1.010 D1511376at2759
OrthoFinder 1 1.000 FOG0002504
OrthoInspector 1 1.000 T618753
orthoMCL 1 0.900 OOG5_131843
Panther 1 1.100 O PTHR13025
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.