DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and Efhd2

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001026818.1 Gene:Efhd2 / 298609 RGDID:1307585 Length:239 Species:Rattus norvegicus


Alignment Length:212 Identity:112/212 - (52%)
Similarity:148/212 - (69%) Gaps:2/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NASSASNKDSVDSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQ 70
            |.::|:..::.|..:....:...||:..|.||.::  :|..|.....:.:|.|.||:|.||||.|
  Rat    30 NGAAAAAAEAPDETAQALGSADDELSAKLLRRADL--NQGIGEPQSPSRRVFNPYTEFKEFSRKQ 92

  Fly    71 IKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFR 135
            |||.:|.|..||..:|||:||.|||.|||||||||||||||.||.|||||.|.|:||||||||||
  Rat    93 IKDMEKMFKQYDAGKDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFR 157

  Fly   136 KAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEE 200
            ||.||||..||||:.||||:|:||...||.|||||||||::....:::|.:||:||||||:::.|
  Rat   158 KAAAGELQEDSGLHVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAE 222

  Fly   201 ERAQRRQQFQQRAAIFQ 217
            |..||:..|::..:.|:
  Rat   223 EVKQRKAAFKELQSTFK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 41/57 (72%)
Efhd2NP_001026818.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 3/20 (15%)
EFh 95..153 CDD:238008 41/57 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340707
Domainoid 1 1.000 96 1.000 Domainoid score I7152
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32580
Inparanoid 1 1.050 215 1.000 Inparanoid score I3533
OMA 1 1.010 - - QHG52325
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - otm45516
orthoMCL 1 0.900 - - OOG6_105725
Panther 1 1.100 - - LDO PTHR13025
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.