| Sequence 1: | NP_001286078.1 | Gene: | CG10431 / 35157 | FlyBaseID: | FBgn0032730 | Length: | 762 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_696166.2 | Gene: | zbtb48 / 567773 | ZFINID: | ZDB-GENE-030131-4450 | Length: | 760 | Species: | Danio rerio |
| Alignment Length: | 362 | Identity: | 90/362 - (24%) |
|---|---|---|---|
| Similarity: | 132/362 - (36%) | Gaps: | 84/362 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 459 ESNRG-----LVATEQSEYWPLEWHNSPVS--KQPR--KKIDILDMQSSFLHHKDLIPTATQLSA 514
Fly 515 PAPDPQLVAVTASYAKLANRYR--KLQLKCKKL------------KSPRKVHRKT---YVCRMCR 562
Fly 563 KGFSKFKNLHHH----------------------RRQKAHFVKL--IPNFSGRCSGCLKFFRSRL 603
Fly 604 GLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAFA------HWRLYRRHELNCRP-------KKS 655
Fly 656 KTKVQTAMNSKKKVTPTQVFECNICKKSFGSLNGLRQHNITHSTERQHKCGICERVFKRRNGLSQ 720
Fly 721 HIKGYHLQLKPHECPVCQHRYALKCDMLRCRHSLRKG 757 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10431 | NP_001286078.1 | THAP | 4..81 | CDD:283206 | |
| zf-AD | 123..192 | CDD:214871 | |||
| zf-C2H2_6 | 674..700 | CDD:290623 | 9/25 (36%) | ||
| C2H2 Zn finger | 677..697 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 705..726 | CDD:275368 | 7/20 (35%) | ||
| zbtb48 | XP_696166.2 | BTB | 18..109 | CDD:279045 | |
| BTB | 35..116 | CDD:197585 | |||
| C2H2 Zn finger | 324..344 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 336..359 | CDD:290200 | 7/22 (32%) | ||
| C2H2 Zn finger | 352..403 | CDD:275368 | 11/50 (22%) | ||
| C2H2 Zn finger | 383..402 | CDD:275368 | 7/18 (39%) | ||
| C2H2 Zn finger | 411..432 | CDD:275368 | 4/20 (20%) | ||
| C2H2 Zn finger | 440..461 | CDD:275368 | 9/28 (32%) | ||
| C2H2 Zn finger | 469..490 | CDD:275368 | 4/20 (20%) | ||
| COG5048 | <495..643 | CDD:227381 | 31/113 (27%) | ||
| C2H2 Zn finger | 498..518 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 510..535 | CDD:290200 | 7/25 (28%) | ||
| C2H2 Zn finger | 526..546 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 538..562 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 554..571 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 586..603 | CDD:275368 | 3/17 (18%) | ||
| zf-H2C2_2 | 596..620 | CDD:290200 | 4/10 (40%) | ||
| C2H2 Zn finger | 611..631 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24406 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||