DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10431 and zbtb48

Sequence 1:NP_001286078.1 Gene:CG10431 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:XP_696166.2 Gene:zbtb48 ZFINID:ZDB-GENE-030131-4450 Length:760 Species:Danio rerio

Alignment Length:362 Identity:90/363 (25%)
Similarity:132/363 (36%) Gaps:84/363 (23%)


  Fly   459 ESNRG-----LVATEQSEYWPLEWHNSPVS--KQPR--KKIDILDMQSSFLHHKDLIPTATQLSA 514
            :|:||     ::.....||.|   |:||.|  |.||  :|....:.::.....||....|.|   
Zfish   265 DSDRGGSVDIIIEGTDEEYVP---HDSPCSSTKTPRGKRKEKSSNKKNGEGTSKDSKKGAVQ--- 323

  Fly   515 PAPDPQLVAVTASYAKLANRYR--KLQLKCKKL------------KSPRKVHRKT---YVCRMCR 562
             .|......::..|.|:.||..  :...||.|.            ...|....:|   :.|..|.
Zfish   324 -CPTCHKTFLSKYYLKVHNRRHTGEKPFKCGKCGKCYFRKENLLEHEARNCLTRTELVFSCSKCS 387

  Fly   563 KGFSKFKNLHHH----------------------RRQKAHFVKL--IPNFSGRCSGCLKFFRSRL 603
            ..|.|.:.|.||                      |..|.|.:|:  .|. ...|..|.|.|.||.
Zfish   388 MTFKKRQELRHHTVMHTGVMPNKCTSCPEQFMQKRDLKIHMIKVHGAPK-PHACPLCPKCFLSRT 451

  Fly   604 GLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAFA------HWRLYRRHELNCRP-------KKS 655
            .||.|        ....||..:.|.|..|...|.:      |.:...|:|   ||       ...
Zfish   452 ELRLH--------EASKHRGEKLFVCEECGHRASSRNGLQMHIKAIHRNE---RPFVCQLCNHAF 505

  Fly   656 KTKVQTAMNSKKKVTPTQVFECNICKKSFGSLNGLRQHNITHSTERQHKCGICERVFKRRNGLSQ 720
            ..|...:|:.:.. |..:.|:|::|.|:|.:...|.:|:.||:.||...|..||:.|..:..|.:
Zfish   506 TQKANLSMHLRTH-TGEKPFQCHLCGKTFRTQASLDKHHRTHTGERPFSCEFCEQRFTEKGPLLR 569

  Fly   721 HIKGYHLQLKPHECPVCQHRYALKCDMLRCRHSLRKG 757
            ||...|.:.:||.|.:|...:. ..:.||......||
Zfish   570 HIASKHQEGRPHFCQICNKTFK-AIEQLRVHVRRHKG 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 9/26 (35%)
C2H2 Zn finger 677..697 CDD:275368 7/20 (35%)
C2H2 Zn finger 705..726 CDD:275368 7/21 (33%)
zbtb48XP_696166.2 BTB 18..109 CDD:279045
BTB 35..116 CDD:197585
C2H2 Zn finger 324..344 CDD:275368 5/20 (25%)
zf-H2C2_2 336..359 CDD:290200 7/23 (30%)
C2H2 Zn finger 352..403 CDD:275368 11/51 (22%)
C2H2 Zn finger 383..402 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..432 CDD:275368 4/21 (19%)
C2H2 Zn finger 440..461 CDD:275368 9/29 (31%)
C2H2 Zn finger 469..490 CDD:275368 4/21 (19%)
COG5048 <495..643 CDD:227381 31/114 (27%)
C2H2 Zn finger 498..518 CDD:275368 2/20 (10%)
zf-H2C2_2 510..535 CDD:290200 7/26 (27%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 538..562 CDD:290200 10/24 (42%)
C2H2 Zn finger 554..571 CDD:275368 6/17 (35%)
C2H2 Zn finger 586..603 CDD:275368 3/18 (17%)
zf-H2C2_2 596..620 CDD:290200 4/11 (36%)
C2H2 Zn finger 611..631 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.