DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10431 and thap3

Sequence 1:NP_001286078.1 Gene:CG10431 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_001014316.1 Gene:thap3 ZFINID:ZDB-GENE-050327-4 Length:213 Species:Danio rerio

Alignment Length:234 Identity:54/235 (23%)
Similarity:95/235 (40%) Gaps:52/235 (22%)


  Fly     1 MPAHCAVINCSHKYVHAG-SISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGDEDF 64
            ||..|:..||:::|.:.. .|:||||||.:..:|::|.:...|. .:.|.|...:||.||..:.|
Zfish     1 MPKSCSASNCTNRYNNKNPEITFHRFPFSKPSVLKQWLDNIGRD-DFQPRKHMVICSLHFTPDCF 64

  Fly    65 NCSNNRKTLKKNAVPSI-RVSEDD---------------SMSGHLEQVSPSNRPTHKQTLSSAAE 113
            :...|||.|..||||:: .|...|               |.|...:.::|...|...:.:....:
Zfish    65 SGLGNRKNLLWNAVPTLFAVPTQDANQNNFRKRLKRALQSASEKWDGITPDGLPLFTEEMHEDTQ 129

  Fly   114 SAATGVKATCRFCGSSAINCSSFDKSFELFGMIQKCFPTLQILQDDTLPKEICQECCLQLERFSQ 178
            .......|.|:   |:.:..:: |.::.|                        .:.|....|...
Zfish   130 DCNNNEVADCQ---STKVFAAA-DHTYAL------------------------SDACTTKARLFN 166

  Fly   179 FIDVVMLAQSELQRKYR--RQLKIK----QEPLVRVKQE 211
            .:|.....:..||.|.|  :::|:|    |..|:.::|:
Zfish   167 ILDANRWLRKRLQAKCRVIKRMKLKLKDAQRELLTLRQQ 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206 29/78 (37%)
zf-AD 123..192 CDD:214871 9/69 (13%)
zf-C2H2_6 674..700 CDD:290623
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 705..726 CDD:275368
thap3NP_001014316.1 THAP 4..82 CDD:283206 29/79 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001243
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.