DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10431 and znf384

Sequence 1:NP_001286078.1 Gene:CG10431 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:XP_012821830.1 Gene:znf384 XenbaseID:XB-GENE-979648 Length:564 Species:Xenopus tropicalis

Alignment Length:484 Identity:112/485 (23%)
Similarity:175/485 (36%) Gaps:142/485 (29%)


  Fly   361 PIVTNVSQIPNPMICELLPQPAPPTSIKPNIVVLN----DSVVESSAAFRLHNCTLCTAKF---- 417
            |.|..||.       :.:|...|...| .|.:.||    ..:.|.......|..||.|...    
 Frog    13 PAVPTVSG-------QTIPHSYPSQQI-DNSMFLNKVKEQLIQEKGCNLSSHYPTLLTVPTSMSL 69

  Fly   418 ---ITIDS---LNQH-YAHSHSNSTPMVSVPPMNICLPSLTMNPPMKMESNRGLVATEQS----- 470
               |::|:   :..| ..||.::.|..::|.|:          |...:.:..|||.|..|     
 Frog    70 PAGISMDTDSKVELHGIQHSQASVTQNITVLPV----------PTTGLMTATGLVITSPSGSLVT 124

  Fly   471 ------EYWPLEWHNSP----VSKQPRKKIDILDMQSSFLHHK--DLIPTATQLSAPA------P 517
                  :.:|:   .:|    ||..|..:  .|.:.|.....|  :|..|.|..|...      |
 Frog   125 TPSSSCQTFPI---TAPSTMIVSTLPGSQ--TLQVVSDLTKAKISELGATGTLKSGRGRKKKRLP 184

  Fly   518 DPQLVAVTASYAKLANR-----------YR------------------KLQLKCKKLKSPR---- 549
            :|.|..:...| .|:|.           ||                  |...:.|..|.|.    
 Frog   185 EPTLPDLNDPY-DLSNEDEDDHQKDGKTYRCRMCSITFFSKSEMQIHSKSHTEAKPHKCPHCSKS 248

  Fly   550 -----------KVH--RKTYVCRMCRKGFSKFKNLHHHRR--QKAHFVKLIPNFSGRCSGCLKFF 599
                       ::|  .|.|.|..|:|.|.:..:|..|.|  .|.|.....|:   :|..|.|.|
 Frog   249 FANSSYLAQHVRIHSGAKPYTCTYCQKAFRQLSHLQQHTRIHLKVHGAVSKPH---KCPHCSKTF 310

  Fly   600 RSRLGLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAF-------AHWRLYRR-HELNCRPKKSK 656
            .:...|.||:|.         |..::.:.|.:||. ||       .|.|::.: |.:..:|.|..
 Frog   311 ANSSYLYQHVRI---------HSGVKPYNCSYCQK-AFRQLSHLQQHSRIHTKVHSIVSKPYKCP 365

  Fly   657 TKVQTAMNSK------KKVTPTQVFECNICKKSFGSLNGLRQHNITHSTERQHKC---GICERVF 712
            ...:|..||.      :..:..:.:.||.|:|:|..|:.|:||...|:.:|.:||   | |::.|
 Frog   366 HCSKTFANSSYLHQHLRIHSGAKPYNCNYCQKAFRQLSHLQQHTRIHTGDRPYKCVHPG-CDKAF 429

  Fly   713 KRRNGLSQHIKGYHLQLKPHECPVCQHRY 741
            .:.:.|..| :..|.:.||.:|..|...|
 Frog   430 TQLSNLQSH-RRQHNKDKPFKCHNCHRAY 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 10/26 (38%)
C2H2 Zn finger 677..697 CDD:275368 9/20 (45%)
C2H2 Zn finger 705..726 CDD:275368 6/24 (25%)
znf384XP_012821830.1 C2H2 Zn finger 214..234 CDD:275368 1/20 (5%)
zf-H2C2_2 226..251 CDD:290200 4/25 (16%)
COG5048 <241..453 CDD:227381 59/227 (26%)
C2H2 Zn finger 242..262 CDD:275368 1/20 (5%)
C2H2 Zn finger 270..290 CDD:275368 7/20 (35%)
C2H2 Zn finger 303..323 CDD:275368 8/29 (28%)
C2H2 Zn finger 331..351 CDD:275368 7/21 (33%)
C2H2 Zn finger 364..384 CDD:275368 3/20 (15%)
C2H2 Zn finger 392..412 CDD:275368 9/20 (45%)
zf-H2C2_2 404..431 CDD:290200 10/28 (36%)
C2H2 Zn finger 420..442 CDD:275368 6/24 (25%)
C2H2 Zn finger 450..470 CDD:275368 3/9 (33%)
C2H2 Zn finger 480..500 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.