DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10431 and THAP6

Sequence 1:NP_001286078.1 Gene:CG10431 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_653322.1 Gene:THAP6 HGNCID:23189 Length:222 Species:Homo sapiens

Alignment Length:250 Identity:59/250 (24%)
Similarity:92/250 (37%) Gaps:45/250 (18%)


  Fly     5 CAVINCSHKYV---HAGSISFHRFP----FKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGDE 62
            |:.|.|:.:.:   ....::||.||    .|||.:|...:.....:..|.|.|...||||||...
Human     5 CSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKT 69

  Fly    63 DFNCSNNRKTLKKNAVPSIRVSEDDS---MSGHLEQVSPSNRPTHKQTLSSAAESAATGVKATCR 124
            ||:.|.....||...:|||    .||   :.|..|::......|.|...::.......|..:...
Human    70 DFDRSAPNIKLKPGVIPSI----FD
SPYHLQGKREKLHCRKNFTLKTVPATNYNHHLVGASSCIE 130

  Fly   125 FCGSSAINCSSFDKSFELFGMIQKCFPTLQILQDDTLPKEICQECCLQLERFSQFIDVVMLAQSE 189
            ...|..|    |:.|:.:....:|.             |........:||...:.:..|:..:..
Human   131 EFQSQFI----FEHSYSVMDSPKKL-------------KHKLDHVIGELEDTKESLRNVLDREKR 178

  Fly   190 LQRKYRRQLK-IKQEPLVRVKQEACESLDNLFPDELDMGLEQDDGCDQEETEQKF 243
            .|:..|:.:: :|.|.|  :.||....||....|           |.||..||.:
Human   179 FQKSLRKTIRELKDECL--ISQETANRLDTFCWD-----------CCQESIEQDY 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206 27/83 (33%)
zf-AD 123..192 CDD:214871 10/69 (14%)
zf-C2H2_6 674..700 CDD:290623
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 705..726 CDD:275368
THAP6NP_653322.1 THAP 4..90 CDD:214951 28/89 (31%)
HCFC1-binding motif (HBM). {ECO:0000250} 139..142 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.