DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10431 and LOC103694540

Sequence 1:NP_001286078.1 Gene:CG10431 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:XP_017457927.1 Gene:LOC103694540 RGDID:9203794 Length:803 Species:Rattus norvegicus

Alignment Length:771 Identity:152/772 (20%)
Similarity:256/772 (33%) Gaps:240/772 (31%)


  Fly    62 EDFNCSN--NRKTLKKNAVPSIRVSEDDSMSGHLEQVSPSNRPTHKQTLSSAAESAATGVKATCR 124
            ||.:|||  ....:..|.:...:|.:.|:    .|:||.:..|......||...::.|..:   .
  Rat    94 EDVHCSNILEETDISDNVIIPEQVLDLDT----AEEVSLAQFPIPDILASSITSTSLTMPE---H 151

  Fly   125 FCGSSAINCSSFDKSFELFGMIQKCFPTLQILQD---------DTLPKEICQ----ECCLQLERF 176
            ...|.||:.|.       .|.|:      |::.|         |.|..:|.:    :|..:    
  Rat   152 ILMSEAIHVSD-------VGHIE------QVIHDSLVETEVITDPLTADISEILVTDCASE---- 199

  Fly   177 SQFIDVVMLAQSELQRKYRRQLKIKQEPLVRVKQEACESLDNLFPDELDMGLEQDDGCDQEETEQ 241
                  .:|..|.:..:.:...|:.::..:.:      |||       |.|..:::|..:..|..
  Rat   200 ------AVLDSSGMPLEQQDDTKVNRDDYLMI------SLD-------DAGKTENEGSSEVTTNA 245

  Fly   242 KFQFCEFPMLN--AQDIINNCDIMEIINLDDPFINIPDDADVGQSERLQPGRTAN----EML--- 297
            :.:...: .||  :.::|.    :.|...|      |::.|||::..:...:|.|    |::   
  Rat   246 ESESDPY-KLNETSPEVIK----VYIFKAD------PEEDDVGETVDIVESKTDNGNEAEVIDQS 299

  Fly   298 -------QNELLTEEHNYAKEEWQLPPHQYKTEKVEGTDAAPDAAPPPADPPPLQDNIDPPSAPE 355
                   .|..:....:..:||        .|:.:.|.:.|.|.|...::.....|:.:..:|..
  Rat   300 SSIYVPRDNVYMPVSDSQKEEE--------DTKVIVGDEDAGDTAADTSEHEQQMDDSEIKAAFL 356

  Fly   356 PRSCKPIVTNVSQIPNPMICELLPQPAPPTSIKPNIVVLNDSVVESSAAFRLHN----------- 409
            |.:......|.|.       |:..|....::      ||:.:  ||....|:|.           
  Rat   357 PIAWAAAYDNNSD-------EIEEQNVTASA------VLHQN--ESGGLDRVHKQKAKKKKRPES 406

  Fly   410 --------------------CTLCTAKFITIDSLNQHYAHSHSNSTPMVSVPPMNICLPSLTMNP 454
                                |..|..||.|...|.:|                        ..|.
  Rat   407 KQYQTAIIVAPDGQTLIVYPCMFCGKKFKTKSFLKRH------------------------IKNH 447

  Fly   455 PMKMESNRGLVATEQSEYWPLEWHNSPVSKQPRKKIDILDMQSSFLHHKDLIPTATQLSAPAPDP 519
            |..:...:              :|.:.......|||.:.:...|   ||..|.|...........
  Rat   448 PEYLAKKK--------------YHCTDCDYSTNKKISLHNHMES---HKLTIKTEKTTECDDCGK 495

  Fly   520 QLVAVTASYAKLANRYRKLQLKCKKLKSPRKVHRKTYVCRMCRKGFSKFKNLHHHRRQKAHFVKL 584
            .|     |:|...         |...|...|| .|||.|:.|....::..:|:||  ..|...|.
  Rat   496 HL-----SHAGTL---------CTHKKEKEKV-SKTYKCKFCDYETAEQTSLNHH--LLAVHSKK 543

  Fly   585 IPNFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAFAHWRLYRRHELN 649
            .|:.   |..|.|.||....|::|:|.         |...:.::|::|:         |:    :
  Rat   544 YPHV---CVECGKGFRHPSELKKHIRV---------HTGEKPYQCQYCE---------YK----S 583

  Fly   650 CRPKKSKTKVQTAMNSKKKVTPTQVFECNICKKSFGSLNGLRQHNITHSTERQHKCGICERVFKR 714
            ......||.::|   ...|..|   .:|.||..:|......:||.:.|...|.|:|..|......
  Rat   584 ADSSNLKTHIKT---KHSKDIP---LKCGICLMTFSDTKEAQQHALIHQENRTHQCSYCNHKSSN 642

  Fly   715 RNGLSQHIKGYHLQLKPHECPVCQ---HRYA-LK--------CDMLRCRHSLRKGP 758
            .:.|.:||...|.:..||:|.:|.   ||.: ||        ..|.:|||...|.|
  Rat   643 SSDLKRHIISVHTKDYPHKCDMCSKGFHRPSELKKHVATHKSKKMHQCRHCDFKSP 698

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206 6/21 (29%)
zf-AD 123..192 CDD:214871 14/82 (17%)
zf-C2H2_6 674..700 CDD:290623 7/26 (27%)
C2H2 Zn finger 677..697 CDD:275368 6/20 (30%)
C2H2 Zn finger 705..726 CDD:275368 5/21 (24%)
LOC103694540XP_017457927.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24406
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.