DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10431 and LOC100493491

Sequence 1:NP_001286078.1 Gene:CG10431 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:XP_002935921.1 Gene:LOC100493491 XenbaseID:XB-GENE-5752757 Length:182 Species:Xenopus tropicalis

Alignment Length:231 Identity:58/232 (25%)
Similarity:85/232 (37%) Gaps:64/232 (28%)


  Fly     1 MPAHCAVINCSHKYVHAGSISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGDEDFN 65
            ||| ||.|||:.:.......||||||..|.::|:|| ....|..::.||..:.|||.||.:..|:
 Frog     1 MPA-CAAINCTSRQTRGCGKSFHRFPHGRPEVLKKW-VMNMRRDKFKPSSKAVLCSDHFEEFCFD 63

  Fly    66 CSNNRKTLKKNAVPSIRV----SEDDSMSGHL-------EQVSPSNRPTHKQTLSSAAESAATGV 119
            .:.....|:.:|||::..    .:.|..|.|.       |:.|..:....:.|:....|...|..
 Frog    64 RTGQTIRLRTDAVPTVFAFPGKMKKDRKSRHSAIVFEYPEEPSQYSFSFQEPTMQEPNEKCVTAE 128

  Fly   120 KATCRFCGSSAINCSSFDKSFELFGMIQKCFPTLQILQDDTLPKEICQECCLQLERFSQFIDVVM 184
            ...|                      |.....||:...||.|                       
 Frog   129 HDYC----------------------ITDSPRTLKKRLDDAL----------------------- 148

  Fly   185 LAQSELQRKYRRQLKIKQEPLVRV--KQEACESLDN 218
               ..|| ..:|:|||.|:...|:  |.:|.|..:|
 Frog   149 ---GSLQ-SMKRRLKITQQKFRRLKFKVQALELAEN 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206 28/77 (36%)
zf-AD 123..192 CDD:214871 9/69 (13%)
zf-C2H2_6 674..700 CDD:290623
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 705..726 CDD:275368
LOC100493491XP_002935921.1 THAP 4..80 CDD:283206 28/77 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001243
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.