DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10431 and znf1014

Sequence 1:NP_001286078.1 Gene:CG10431 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_001108370.1 Gene:znf1014 ZFINID:ZDB-GENE-080220-9 Length:508 Species:Danio rerio

Alignment Length:238 Identity:61/239 (26%)
Similarity:95/239 (40%) Gaps:48/239 (20%)


  Fly   545 LKSPRKVH--RKTYVCRMCRKGFSK---FKNLHHHRRQKAHFV-----------------KLI-- 585
            ||:.:|:|  ::.|.|..|:|.|.:   ||..|....::..|.                 |||  
Zfish   247 LKAHQKIHTEKRPYKCAFCQKTFKQSGAFKKHHRIHSEEKPFACDECGKSFKWENSLQIHKLIHS 311

  Fly   586 --PNFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAFAHWRLYRRH-- 646
              ..||  |..|.|.|..:..|:.||         .:|...:.:.|..| ...|....:::.|  
Zfish   312 GEKQFS--CDQCGKKFVQKSDLKTHM---------MSHTGEKPYSCAVC-GKGFVRLSVFKNHQK 364

  Fly   647 ------ELNCRPKKSKTKVQTAMNSKKKV-TPTQVFECNICKKSFGSLNGLRQHNITHSTERQHK 704
                  |..|..........|.:|:.:|: |..:.::|:.|:|||.|...|:.|...|:.|:.:.
Zfish   365 AHAGVKEFVCSDCGKAFTTSTLLNAHQKIHTGEKPYKCSYCEKSFTSSGSLQGHERIHTGEKPYT 429

  Fly   705 CGICERVFKRRNGLSQHIKGYHLQLKPHECPVCQHRYALKCDM 747
            |..|.:.||.|..|..| |..|...||.:|..|...:..|.|:
Zfish   430 CDECGKSFKWRRSLQIH-KLIHSGEKPFDCDQCGKTFVQKSDL 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 9/26 (35%)
C2H2 Zn finger 677..697 CDD:275368 8/20 (40%)
C2H2 Zn finger 705..726 CDD:275368 8/21 (38%)
znf1014NP_001108370.1 C2H2 Zn finger 66..86 CDD:275368
COG5048 90..476 CDD:227381 61/239 (26%)
C2H2 Zn finger 94..114 CDD:275368
C2H2 Zn finger 122..142 CDD:275368
C2H2 Zn finger 150..170 CDD:275368
C2H2 Zn finger 178..198 CDD:275368
C2H2 Zn finger 206..226 CDD:275368
C2H2 Zn finger 234..254 CDD:275368 3/7 (43%)
C2H2 Zn finger 262..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 290..310 CDD:275368 3/20 (15%)
C2H2 Zn finger 318..338 CDD:275368 7/29 (24%)
C2H2 Zn finger 346..366 CDD:275368 4/21 (19%)
C2H2 Zn finger 374..394 CDD:275368 4/20 (20%)
C2H2 Zn finger 402..422 CDD:275368 8/20 (40%)
C2H2 Zn finger 430..450 CDD:275368 8/21 (38%)
C2H2 Zn finger 458..478 CDD:275368 4/15 (27%)
C2H2 Zn finger 486..503 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.