DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: L2HGDH and L2HGDH

Sequence 1:NP_001286076.1 Gene:L2HGDH FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_079160.1 Gene:L2HGDH HGNCID:20499 Length:463 Species:Homo sapiens

Alignment Length:424 Identity:236/425 (56%)
Similarity:308/425 (72%) Gaps:10/425 (2%)


  Fly    37 SSSCGDYDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGT 101
            |:|...:|:|:|||||||.||||.::||||||.:.|||||..||.||:||||||||:||||||.:
Human    43 SASTSSFDIVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPES 107

  Fly   102 LKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEI 166
            |||:|||:|..|.|.|..:|.|.||:.||||||.:::|:..|:.|.::|:.|.||.||:|:..:|
Human   108 LKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDI 172

  Fly   167 QEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKFTETKE-------GTD 224
            ::.||||:|:||:..|||||||:..|...:.|||::.||.:..:|.|......||       |..
Human   173 KKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQ 237

  Fly   225 YPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIY 289
            ||:.|...| |:.:|.:.|:||.||.||.::|.:||..|||||||||:||||..||.::||||||
Human   238 YPIVIKNTK-GEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIY 301

  Fly   290 PVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIG 354
            ||||.||||||||||||||||||||||||||.|||||...|.:..::.|.:...|.:|:||:...
Human   302 PVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFS 366

  Fly   355 FGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALA 419
            :|::||.|:.|:...:|.|||:||:||..||.||||||||||:|.|||||:|||||.|.|.  :.
Human   367 YGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGD--IG 429

  Fly   420 KRVLHCRNAPSPGATSSLAIAKMIADKIENEFSI 453
            .|:||.||||||.||||:||:.||||:::..|.:
Human   430 NRILHVRNAPSPAATSSIAISGMIADEVQQRFEL 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 224/398 (56%)
NADB_Rossmann 69..440 CDD:304358 210/378 (56%)
L2HGDHNP_079160.1 NADB_Rossmann 31..448 CDD:304358 231/412 (56%)
PRK11728 61..457 CDD:183292 224/403 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173498763
eggNOG 1 0.900 E1_COG0579
Hieranoid 1 1.000
Homologene 1 1.000 H11767
Inparanoid 1 1.050 478 1.000 Inparanoid score I1468
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1310154at2759
OrthoFinder 1 1.000 FOG0006192
OrthoInspector 1 1.000 T1074238
orthoMCL 1 0.900 OOG5_127956
Panther 1 1.100 LDO PTHR43104
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2601
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.