DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: L2HGDH and L2hgdh

Sequence 1:NP_001286076.1 Gene:L2HGDH FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001101498.1 Gene:L2hgdh RGDID:1306250 Length:463 Species:Rattus norvegicus

Alignment Length:424 Identity:226/425 (53%)
Similarity:308/425 (72%) Gaps:10/425 (2%)


  Fly    37 SSSCGDYDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGT 101
            |||...:|:|:|||||||.||||.::|:||.|.:.|:|||..||.||:|.||||||:||||||.:
  Rat    43 SSSTSSFDIVIVGGGIVGLASARTLILKHPELSIGVVEKEKDLALHQTGRNSGVIHSGIYYKPES 107

  Fly   102 LKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEI 166
            |||:|||||..|.|.|.:.|.|||::.||||||.:::|:..|:.|.:||:.|.|..||:|:..:|
  Rat   108 LKAKLCVEGAALIYEYCNLKGIPYRQCGKLIVAVEQEEIPRLQALYERGLQNGVQGLRLIQQEDI 172

  Fly   167 QEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKF-------TETKEGTD 224
            ::.||||:|:||:..|:||||::..|...:.|||::.||.|..||.|...       ..:|:|..
  Rat   173 KKKEPYCRGLMAIDCPYTGIVNYQQVALSFAQDFQEAGGSILKDFEVKDIGIAKEDPPRSKDGMK 237

  Fly   225 YPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIY 289
            ||:.:..:| |:.::.:.|:||.||.||.::|.:||..||:||||||:||:|..||.::||||||
  Rat   238 YPIAVKNSK-GKEIQCRYVVTCAGLYSDRISELSGCNPDPQIVPFRGDYLVLKPEKGYLVKGNIY 301

  Fly   290 PVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIG 354
            ||||.|.||||||||||:|||||||||||||.|||||...|.|..::.:.:...||:|:..:...
  Rat   302 PVPDSRLPFLGVHFTPRLDGSIWLGPNAVLAFKREGYRPFDFNARDIMEVILKSGFIKLVFQNFS 366

  Fly   355 FGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALA 419
            :|.||:.|:.|::..:|.|||:||:||..|:.||||||||||:|.|||||||||||  .|:|.:.
  Rat   367 YGASEIYKACFLSETVKHLQKFIPEITTNDVLRGPAGVRAQALDRDGNLVDDFVFD--GGAGEIG 429

  Fly   420 KRVLHCRNAPSPGATSSLAIAKMIADKIENEFSI 453
            .|:||.||||||.|||||||::|||::::..|.:
  Rat   430 DRILHVRNAPSPAATSSLAISRMIAEEVQQRFKL 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 213/398 (54%)
NADB_Rossmann 69..440 CDD:304358 202/378 (53%)
L2hgdhNP_001101498.1 NADB_Rossmann 49..448 CDD:304358 217/402 (54%)
PRK11728 61..457 CDD:183292 213/399 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173502836
eggNOG 1 0.900 E1_COG0579
Hieranoid 1 1.000
Homologene 1 1.000 H11767
Inparanoid 1 1.050 463 1.000 Inparanoid score I1467
OMA 1 1.010
OrthoDB 1 1.010 D1310154at2759
OrthoFinder 1 1.000 FOG0006192
OrthoInspector 1 1.000 T1087883
orthoMCL 1 0.900 OOG5_127956
Panther 1 1.100 LDO PTHR43104
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.