DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: L2HGDH and L2hgdh

Sequence 1:NP_001286076.1 Gene:L2HGDH FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_663418.1 Gene:L2hgdh MGIID:2384968 Length:464 Species:Mus musculus

Alignment Length:424 Identity:227/425 (53%)
Similarity:313/425 (74%) Gaps:10/425 (2%)


  Fly    37 SSSCGDYDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGT 101
            |||...:|:|:|||||||.||||.::|:||.|.:.|:|||..||.||:||||||||:||||||.:
Mouse    44 SSSTSSFDIVIVGGGIVGLASARTLILKHPGLSIGVVEKEKDLALHQTGHNSGVIHSGIYYKPES 108

  Fly   102 LKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEI 166
            |||:|||||..|.|.|.:.|.|||::.||||||.:::|:..|:.|.:||:.|.|..||:|:..:|
Mouse   109 LKAKLCVEGAALIYEYCNLKGIPYRQCGKLIVAVEQEEIPRLQALYERGLQNGVEGLRLIQQEDI 173

  Fly   167 QEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNV-------SKFTETKEGTD 224
            ::.||||:|:||:..|:||||::..|...:.|||::.||.|..||.|       ...:.:|:|.:
Mouse   174 KKKEPYCRGLMAIDCPYTGIVNYQQVALSFAQDFQEAGGSILRDFEVKGIEIAKENSSRSKDGMN 238

  Fly   225 YPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIY 289
            ||:.:..:| |:.:|.:.|:||.||.||.::|.:||..||:||||||:||:|..||.::||||||
Mouse   239 YPIAVKNSK-GKEIRCRYVVTCAGLYSDRISELSGCNPDPQIVPFRGDYLVLKPEKGYLVKGNIY 302

  Fly   290 PVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIG 354
            ||||.||||||||||||:||:||||||||||.|||||...|.:..::.:.:...||:.:..::..
Mouse   303 PVPDSRFPFLGVHFTPRLDGTIWLGPNAVLAFKREGYRPFDFDARDVMEVILKSGFINLVFQHFS 367

  Fly   355 FGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALA 419
            :|::||.|:.|::..:|.|||:||:||..|:.||||||||||:|.|||||:|||||  .|:|.:|
Mouse   368 YGVNEMYKACFLSETVKHLQKFIPEITISDVLRGPAGVRAQALDRDGNLVEDFVFD--GGTGEIA 430

  Fly   420 KRVLHCRNAPSPGATSSLAIAKMIADKIENEFSI 453
            .||||.||||||.|||||||::|||::.:..|.:
Mouse   431 DRVLHVRNAPSPAATSSLAISRMIAEEAQQRFKL 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 214/398 (54%)
NADB_Rossmann 69..440 CDD:304358 203/378 (54%)
L2hgdhNP_663418.1 NADB_Rossmann 50..449 CDD:304358 218/402 (54%)
PRK11728 62..458 CDD:183292 214/399 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173497413
eggNOG 1 0.900 E1_COG0579
Hieranoid 1 1.000
Homologene 1 1.000 H11767
Inparanoid 1 1.050 466 1.000 Inparanoid score I1522
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006192
OrthoInspector 1 1.000 T1084333
orthoMCL 1 0.900 OOG5_127956
Panther 1 1.100 LDO PTHR43104
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2601
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.