DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: L2HGDH and Y45G12B.3

Sequence 1:NP_001286076.1 Gene:L2HGDH FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_503730.1 Gene:Y45G12B.3 WormBaseID:WBGene00021564 Length:433 Species:Caenorhabditis elegans

Alignment Length:445 Identity:242/446 (54%)
Similarity:315/446 (71%) Gaps:15/446 (3%)


  Fly    11 LRRSLLNV--GVAAPNESTATHKRSQHSSSSCGDYDLVVVGGGIVGAASAREIVLRHPSLKVAVL 73
            |.|....|  |::.|.:          .|.....||||:|||||||.|:||::::..|.||||::
 Worm     2 LNRGTFQVFRGISGPPK----------KSVDLPKYDLVIVGGGIVGCATARQLLIEKPQLKVALI 56

  Fly    74 EKECKLAKHQSGHNSGVIHAGIYYKPGTLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEK 138
            |||.:||.||||||||||||||||.||:|||:|||||:.|:|.:.|::|:|||||||||||.:.:
 Worm    57 EKEKELAVHQSGHNSGVIHAGIYYTPGSLKAKLCVEGLDLSYEFFDKEKVPYKKTGKLIVAVEPE 121

  Fly   139 EVKLLKDLEKRGIANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDFKQC 203
            ||..|..|..|...|...|:.||:.|:|.|:||:|:|:.||.||||||||||.||:.:|:||::.
 Worm   122 EVPRLDALFSRAQTNGCRDIEMIDSSKITELEPHCRGLKALWSPHTGIVDWGYVTKRFGEDFEKR 186

  Fly   204 GGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVP 268
            ||.||..:.:.|.::..: ..||:.:..........|||::||.|||||.:|..:||..||:|||
 Worm   187 GGKIYTSYPLEKISDNHD-PGYPIRVSSGPALAEFETKNLITCAGLQSDRVAALSGCSTDPKIVP 250

  Fly   269 FRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINL 333
            ||||||||..||:|:||.|||||||||||||||||||||:|.||||||||||.|||||::..|:.
 Worm   251 FRGEYLLLKPEKRHLVKTNIYPVPDPRFPFLGVHFTPRMNGDIWLGPNAVLAYKREGYSYFSISP 315

  Fly   334 FELFDALRYPGFVKMASKYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMD 398
            .:|.::|.|.|..|:..|:..||:.|:.:..:|..|:|.||::||::...|:.||||||||||||
 Worm   316 SDLLESLSYSGMQKLVKKHFTFGIKELYRGVWIAAQVKQLQRFIPELKLSDVTRGPAGVRAQAMD 380

  Fly   399 LDGNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSSLAIAKMIADKIENEFSI 453
            ..||||||||||  .|:|.|:..::|.||||||.|||||||||||..:..|.|.:
 Worm   381 SAGNLVDDFVFD--SGTGKLSPLLMHVRNAPSPAATSSLAIAKMITSEAINRFKL 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 223/391 (57%)
NADB_Rossmann 69..440 CDD:304358 214/371 (58%)
Y45G12B.3NP_503730.1 PRK11728 24..427 CDD:183292 234/406 (58%)
NADB_Rossmann 26..420 CDD:304358 230/397 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173100865
eggNOG 1 0.900 E1_COG0579
Hieranoid 1 1.000
Homologene 1 1.000 H11767
Inparanoid 1 1.050 486 1.000 Inparanoid score I785
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1310154at2759
OrthoFinder 1 1.000 FOG0006192
OrthoInspector 1 1.000 T474342
orthoMCL 1 0.900 OOG5_127956
Panther 1 1.100 LDO PTHR43104
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2601
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.