DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: L2HGDH and l2hgdh

Sequence 1:NP_001286076.1 Gene:L2HGDH FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_002938171.1 Gene:l2hgdh XenbaseID:XB-GENE-5764342 Length:453 Species:Xenopus tropicalis

Alignment Length:418 Identity:244/419 (58%)
Similarity:309/419 (74%) Gaps:10/419 (2%)


  Fly    43 YDLVVVGGGIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPGTLKARLC 107
            ||:|||||||||.||||:::||||:|:.||||||.::|.|||||||||||:||||.||:||||||
 Frog    39 YDVVVVGGGIVGLASARQLILRHPALRFAVLEKEKEIALHQSGHNSGVIHSGIYYTPGSLKARLC 103

  Fly   108 VEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEIQEIEPY 172
            |.|..|.|.|.|:|.||||:.||||||..:.|:..|:.|.:||:.||||.||:|...:|:|.|||
 Frog   104 VRGAALIYEYCDQKGIPYKQCGKLIVAVKQPEIPRLQALYERGLQNNVPGLRLIGAKDIKEKEPY 168

  Fly   173 CQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKFTETKE-------GTDYPVTIH 230
            |:|||||.||:||||::..|.:.|..||...||.:..||.|:......|       |.:|||.|.
 Frog   169 CRGVMALESPYTGIVNYKQVAQSYKDDFCDAGGSVLTDFEVTDIKMVNESPAGSVQGIEYPVAIK 233

  Fly   231 GAKPGQTVRTKNVLTCGGLQSDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPR 295
            ..| |:.|..|.||||.||.||.:::.:||..:||||||||:||:|..||.::|||||||||:||
 Frog   234 NNK-GEEVHCKYVLTCAGLFSDRVSQVSGCSAEPRIVPFRGDYLVLKPEKCYLVKGNIYPVPNPR 297

  Fly   296 FPFLGVHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIGFGLSEM 360
            |||||||||||||||:||||||:||.|||||...|.|..:..:|:.|.|..|:..|.:.:|:.||
 Frog   298 FPFLGVHFTPRMDGSVWLGPNAILAFKREGYRLCDFNARDFKEAVTYSGLHKLVLKNLSYGMGEM 362

  Fly   361 SKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLDGNLVDDFVFDRGQGSGALAKRVLHC 425
            .:::|:|.|:|.|||:||:::..||.|||:||||||:|.|||||||||||  .|||.||..:||.
 Frog   363 YRAFFLNAQLKELQKFIPELSFNDIARGPSGVRAQALDRDGNLVDDFVFD--GGSGDLANCILHV 425

  Fly   426 RNAPSPGATSSLAIAKMIADKIENEFSI 453
            ||||||.|||||||::|||.::|..|.:
 Frog   426 RNAPSPAATSSLAISEMIASEVEERFGL 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 231/398 (58%)
NADB_Rossmann 69..440 CDD:304358 219/378 (58%)
l2hgdhXP_002938171.1 PRK11728 51..447 CDD:183292 231/399 (58%)
NADB_Rossmann 65..452 CDD:304358 224/390 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173501748
eggNOG 1 0.900 E1_COG0579
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H11767
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1310154at2759
OrthoFinder 1 1.000 FOG0006192
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.