DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10621 and HMT2

Sequence 1:NP_001286071.1 Gene:CG10621 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001319825.1 Gene:HMT2 AraportID:AT3G63250 Length:333 Species:Arabidopsis thaliana

Alignment Length:325 Identity:116/326 (36%)
Similarity:181/326 (56%) Gaps:37/326 (11%)


  Fly     8 VKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGYME 72
            |.|||..|:...|..|.  .||||||:...|:|..|.:.|||:|:.|||||.:.:||:::.|: |
plant    21 VIDGGLATEFERHGADL--NDPLWSAKCLVTSPHLIHTVHLDYLEAGADIISSASYQATIQGF-E 82

  Fly    73 YLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQL---SVQEGYPLII-ASIGPFGAHLHDGSE 133
            ......|:|..|:|.:|.:|..|:..|..:|..:..   .:.:..|::: ||:|.:||:|.||||
plant    83 AKGFSREESESLLKKSVEIATEARNSYYDKCGTSSSMDDKILKKRPILVAASVGSYGAYLADGSE 147

  Fly   134 YTGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKF--WVA 196
            |:|.|.|.:..:::.|:||.|::...|:|.|.:|.||||.::||:|..::|  :..|||.  |.:
plant   148 YSGIYGDSITLEKLKDFHRRRLQVLAESGADLIAFETIPNKIEAQAFADLL--EEGDVKIPGWFS 210

  Fly   197 FQCKDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNCVHPKFVTPLFKSLNGDREVGEQI 261
            |..||...:..|::..:..:     :||.  .:|.:|:|:||..|:|:..|...:       |::
plant   211 FNSKDGVNVVSGDSIKECIS-----IAEN--CEKVVAVGINCTPPRFIEGLVLEI-------EKV 261

  Fly   262 ---PLVVYPNSGEVYD------VVNGWQGREHCVPLANYVPEWAQLGAKVIGGCCRTYARDIRHI 317
               |::|||||||.||      |.|...|.|..|   :||.:|...|..::||||||....||.|
plant   262 TSKPILVYPNSGESYDADRKEWVENTGVGDEDFV---SYVEKWMDAGVSLLGGCCRTTPTTIRAI 323

  Fly   318  317
            plant   324  323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 116/326 (36%)
HMT2NP_001319825.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I1287
OMA 1 1.010
OrthoDB 1 1.010 D731388at2759
OrthoInspector 1 1.000 T32253
orthoMCL 1 0.900 OOG5_128779
Panther 1 1.100 O PTHR46015
Phylome 1 0.910 0.957 Consistency score
87.980

Return to query results.
Submit another query.