DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10621 and HMT-1

Sequence 1:NP_001286071.1 Gene:CG10621 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_189219.1 Gene:HMT-1 AraportID:AT3G25900 Length:326 Species:Arabidopsis thaliana

Alignment Length:332 Identity:118/333 (35%)
Similarity:182/333 (55%) Gaps:46/333 (14%)


  Fly     8 VKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGYME 72
            |.||||.||:.:| |.::: ||||||.....||..|...|:::|:.||||::|::||:::.|::.
plant    22 VVDGGFATQLEIH-GAAIN-DPLWSAVSLIKNPELIKRVHMEYLEAGADIVVTSSYQATIPGFLS 84

  Fly    73 Y-LELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGY----PLIIASIGPFGAHLHDGS 132
            . |.::|.:|  |::.:|.||..|::|     :..::|...|:    .|:.||||.:||:|.|||
plant    85 RGLSIEESES--LLQKSVELAVEARDR-----FWEKVSKVSGHSYNRALVAASIGSYGAYLADGS 142

  Fly   133 EYTGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAF 197
            ||:|.|.:.|...::.|:||.|::..:|||.|.||.||||.::||:|.||:|.::...:..|:.|
plant   143 EYSGHYGENVSLDKLKDFHRRRLQVLVEAGPDLLAFETIPNKLEAQACVELLEEEKVQIPAWICF 207

  Fly   198 QCKDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNCVHPKFVTPL---FKSLNGDREVGE 259
            ...|......||:|.:.       |...|..:...|:|:||..|:|:..|   |..|.       
plant   208 TSVDGEKAPSGESFEEC-------LEPLNKSNNIYAVGINCAPPQFIENLIRKFAKLT------- 258

  Fly   260 QIPLVVYPNSGEVYDVVNGWQGR------EHCV---PLANYVPEWAQLGAKVIGGCCRTYARDIR 315
            :..:|||||||||      |.|:      ..|.   ....:..:|..||||:|||||||....|.
plant   259 KKAIVVYPNSGEV------WDGKAKQWLPSQCFGDDEFEMFATKWRDLGAKLIGGCCRTTPSTIN 317

  Fly   316 HIGEAIR 322
            .|...::
plant   318 AISRDLK 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 118/333 (35%)
HMT-1NP_189219.1 PLN02489 1..326 CDD:215269 118/333 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H101205
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D731388at2759
OrthoInspector 1 1.000 T32253
orthoMCL 1 0.900 OOG5_128779
Panther 1 1.100 O PTHR46015
Phylome 1 0.910 0.957 Consistency score
87.930

Return to query results.
Submit another query.