DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10621 and HMT3

Sequence 1:NP_001286071.1 Gene:CG10621 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_566715.1 Gene:HMT3 AraportID:AT3G22740 Length:347 Species:Arabidopsis thaliana

Alignment Length:335 Identity:119/336 (35%)
Similarity:192/336 (57%) Gaps:43/336 (13%)


  Fly     8 VKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGYM- 71
            |.||||.|::..|..|.  .||||||:...|:|..:...|||:|::||:||:|.:||:::.|:: 
plant    25 VVDGGFATELQRHGADI--NDPLWSAKCLITSPHLVTKVHLDYLESGANIIITASYQATIQGFVA 87

  Fly    72 EYLELDEEQSIELIKNTVRLAHIAKERYLTEC--------YQAQLSVQEGYPLII-ASIGPFGAH 127
            :.|.:.|.::  |::.:|.:.:.|:|.:...|        |..:.|.:   |::: ||:|.:||:
plant    88 KGLSVGEAEN--LLRRSVEITYEAREIFYNRCTKGSWDFAYAGKASRR---PILVAASVGSYGAY 147

  Fly   128 LHDGSEYTGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVK 192
            |.|||||:|.|.|.|..:.:.|:||.|::...::|.|.:|.||||.::||||..::|.::..|:.
plant   148 LADGSEYSGIYGDSVSKETLKDFHRRRVQILAKSGADLIAFETIPNKLEAEAYADLLEEEDIDIP 212

  Fly   193 FWVAFQCKDENTLAHGETFADAANAIWDLLAERNAQDKC---LAIGVNCVHPKFVTPLFKSLNGD 254
            .|.:|..||..::..|::..:.|          ...|.|   :|||:||..|:::..|..||   
plant   213 AWFSFTSKDGVSVPRGDSVVECA----------KVADSCKNVVAIGINCTAPRYIHALIISL--- 264

  Fly   255 REVGEQIPLVVYPNSGEVYDVVN-GW-----QGREHCVPLANYVPEWAQLGAKVIGGCCRTYARD 313
            |::..: |:|||||||||||.:| .|     :..|..|   :||.:|...||.:.||||||....
plant   265 RQMTRK-PIVVYPNSGEVYDGLNKKWIKSEGESEEDFV---SYVSKWRDAGASLFGGCCRTTPNT 325

  Fly   314 IRHIGEAIRD 323
            ||.|.:.:.|
plant   326 IRAIAKVLSD 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 118/334 (35%)
HMT3NP_566715.1 PLN02489 2..337 CDD:215269 119/336 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I1287
OMA 1 1.010
OrthoDB 1 1.010 D731388at2759
OrthoInspector 1 1.000 T32253
orthoMCL 1 0.900 OOG5_128779
Panther 1 1.100 LDO PTHR46015
Phylome 1 0.910 0.957 Consistency score
87.980

Return to query results.
Submit another query.