DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10621 and MTR

Sequence 1:NP_001286071.1 Gene:CG10621 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_011542496.1 Gene:MTR HGNCID:7468 Length:1321 Species:Homo sapiens

Alignment Length:349 Identity:73/350 (21%)
Similarity:128/350 (37%) Gaps:115/350 (33%)


  Fly    27 GDPLWSARFNA-------TNPAAIISTHLDFLQNGADIILTNTYQSSVDGYMEYLELDEEQSIEL 84
            |:.::||..:|       .:|.:....:.::|..|||||.|||:.|:.....:|       .:|.
Human   111 GEHVFSAAPSAQGGDSTTCHPRSKTCRNPEYLLAGADIIETNTFSSTSIAQADY-------GLEH 168

  Fly    85 IKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIA-SIGPFGAHLHDGSEYTGSYADFVPAKEIT 148
            :...:.:......|...|    ::::|.|....:| ::||           |.......|:.|..
Human   169 LAYRMNMCSAGVARKAAE----EVTLQTGIKRFVAGALGP-----------TNKTLSVSPSVERP 218

  Fly   149 DWHRVRIEACLEA-----------GVDALAIETIPCQMEAE----ALVEMLCDDYPDVKFWVAFQ 198
            |:..:..:..:||           |||.|.||||.....|:    ||..:..:.|.....:::..
Human   219 DYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGT 283

  Fly   199 CKDEN--------------TLAHGETFADAANAIWDLLAERNAQDKCLAIGVNCVHPKFVTPLFK 249
            ..|::              :::|||.                     |.||:||.          
Human   284 IVDKSGRTLSGQTGEGFVISVSHGEP---------------------LCIGLNCA---------- 317

  Fly   250 SLNGDREVGEQIPLV---------VYPNSG-----EVYDVVNGWQGREHCVPLANYVPEWAQLG- 299
              .|..|:...|.::         .|||:|     ..||        |....:|.::.::|..| 
Human   318 --LGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYD--------ETPSMMAKHLKDFAMDGL 372

  Fly   300 AKVIGGCCRTYARDIRHIGEAIRD 323
            ..::||||.:....||.|.||:::
Human   373 VNIVGGCCGSTPDHIREIAEAVKN 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 73/348 (21%)
MTRXP_011542496.1 metH 140..1317 CDD:236539 68/321 (21%)
MetH1 140..396 CDD:223719 68/319 (21%)
MeTr 427..683 CDD:238381
methionine_synthase_B12_BD 727..953 CDD:239020
Met_synt_B12 1021..1302 CDD:281030
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T609824
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2187
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.