DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10621 and BHMT2

Sequence 1:NP_001286071.1 Gene:CG10621 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_060084.2 Gene:BHMT2 HGNCID:1048 Length:363 Species:Homo sapiens

Alignment Length:346 Identity:79/347 (23%)
Similarity:120/347 (35%) Gaps:92/347 (27%)


  Fly     6 VLVKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGY 70
            |::.||.|  .:|:.....|... ||:......:|.|:...|::||:.|::::.|.|:.:|    
Human    22 VVIGDGSF--LITLEKRGYVKAG-LWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSAS---- 79

  Fly    71 MEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIASIGPFGAHLHDGSEYT 135
                    |.::|.....|..|         .|..|:....:|..|:...|.....:.:...|  
Human    80 --------EDNMESKWEDVNAA---------ACDLAREVAGKGDALVAGGICQTSIYKYQKDE-- 125

  Fly   136 GSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCD-DYPDVKFWVAF-Q 198
                     ..|....|.::|......||.|..|......||...||:|.: |.|     ||. .
Human   126 ---------ARIKKLFRQQLEVFAWKNVDFLIAEYFEHVEEAVWAVEVLKESDRP-----VAVTM 176

  Fly   199 C----KDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNCVHPKF-------VTPLFKSLN 252
            |    .|.:.:..||            .|.|..:.....:||||   :|       ...|.|  .
Human   177 CIGPEGDMHDITPGE------------CAVRLVKAGASIVGVNC---RFGPDTSLKTMELMK--E 224

  Fly   253 GDREVGEQIPLVVYPNSGEVYDVVNGWQGREHCVPLANY-------------VPEWAQ----LGA 300
            |....|.:..|:|.|......|.     |:|..|.|..|             :.::|:    ||.
Human   225 GLEWAGLKAHLMVQPLGFHAPDC-----GKEGFVDLPEYPFGLESRVATRWDIQKYAREAYNLGV 284

  Fly   301 KVIGGCCRTYARDIRHIGEAI 321
            :.|||||......||.|.|.:
Human   285 RYIGGCCGFEPYHIRAIAEEL 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 79/347 (23%)
BHMT2NP_060084.2 S-methyl_trans 23..303 CDD:308273 77/342 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.