DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10600 and RSBN1

DIOPT Version :8

Sequence 1:NP_001137839.1 Gene:CG10600 / 35142 FlyBaseID:FBgn0032717 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_060834.2 Gene:RSBN1 / 54665 HGNCID:25642 Length:802 Species:Homo sapiens

Alignment Length:971 Identity:295/971 - (30%)
Similarity:426/971 - (43%) Gaps:297/971 - (30%)


  Fly    35 AVGASKQ-----RETPEKGVNKASAVENNNANARGNASPTTTSAQ----------REATTTITPV 84
            ||.|.::     :|.|..||:.........:::.|:.......:|          |.:.....|:
Human    61 AVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPL 125

  Fly    85 EPTAAATTTNGNTLPTQQQQQLQSGDGNANNPTTNARIMLAAAEEEQAVASSVATTAGAPTAATT 149
            .||.||.|..|...|                      ::|..........:..|..|..|..:|:
Human   126 PPTNAAPTVPGPVEP----------------------LLLPPPPPPSLAPAGPAVAAPLPAPSTS 168

  Fly   150 TATTTALADTTKTSTSTDEKTGKVKRNSQNTNPMSTNVICTPTHSPTPPTEERNHKRKKRDRERD 214
            ...|                          .:|::.:. ..|.|        :.||      ||.
Human   169 ALFT--------------------------FSPLTVSA-AGPKH--------KGHK------ERH 192

  Fly   215 EDKNRRSNNHNSSSKDRDKDRDRDKERDKERDRERE------RDRNRESSSKSSKEAEHK----S 269
            :..:.|..:.:.||...|.     |.:||:.:.||.      :...||:..::.|.....    .
Human   193 KHHHHRGPDGDPSSCGTDL-----KHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLK 252

  Fly   270 SSSRSKEKYHRSDRDREREKERDREKIPSSSSSSSSHSNRRRSSDSSRSSQNSSFKSKDPGADPV 334
            ...:.|:|.||.|....|.|..::|                                        
Human   253 KIKKKKKKKHREDMRGRRLKMYNKE---------------------------------------- 277

  Fly   335 LPQAVVAALEKQIKVEEVIKKEPVETKQEVDTEPTPVLSNLIKTEAEIKTESTEKPNKPLVNGEA 399
             .|.|.|.|.:       |.||                   |.|:.:|.:.|.       :|.|:
Human   278 -VQTVCAGLTR-------ISKE-------------------ILTQGQINSTSG-------LNKES 308

  Fly   400 IAKTRDEVSRQLNFGDKVSNSKLMPSPAPKSSSGSNSTASNHSSSQSSSSRKSYLSSSSSSSSSN 464
            ....:||...:||.|       :.....|:   |..:....|   |..|.|:::|.:.:..|:..
Human   309 FRYLKDEQLCRLNLG-------MQEYRVPQ---GVQTPFMTH---QEHSIRRNFLKTGTKFSNFI 360

  Fly   465 HHKSSSSSSSRHSSSTSRECSKCYKRSKIRRTSVGVQCLQHAPATGPWQTVQSLPPRPNRKPPAG 529
            |.:..|                                                           
Human   361 HEEHQS----------------------------------------------------------- 366

  Fly   530 LENLKYGCYFQVEQYPNGGASIVHLYQHEIDALSPDEMEELVDEFFEVCFAEDEQGYAHHVMGIV 594
                            ||||.::|.|..|:..|||.|||...:||..:.|:|:|:..|::.:.||
Human   367 ----------------NGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIV 415

  Fly   595 HDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPLHQISL 659
            |.||.||||.|::.|.|:....||..:||: .||||.|:|.::.||.|.||.||:|.||:.||||
Human   416 HGAAAYLPDFLDYFAFNFPNTPVKMEILGK-KDIETTTISNFHTQVNRTYCCGTYRAGPMRQISL 479

  Fly   660 VGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNSILQTDPR-QSNDGPILWIRAGEQLVPTAEL 723
            ||.|.||||.|||:.|..:|.:|||:.|:||...|.|:...| ||:||||:|:|.|||::|||::
Human   480 VGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADM 544

  Fly   724 NSKTPLKRQRTRINELRNLQYLPRLSEARETMIEDRTKAHADHVGHGHERITTAAVGILKAVHCG 788
             .|:|.||:|: :||::|||||||.||.||.:.||||:|||||||.|.:..:|||||:||||..|
Human   545 -PKSPFKRRRS-MNEIKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQFG 607

  Fly   789 QTYSQNRITKDVVAFAAQDFNTMVEMLQLDLHEPPISQCVQWIEDAKLNQLRREGVRYARIQLCD 853
            :...|.||||||:.|.|:||..:|:.|||||||||:||||||:::|||||:||||:|||||||||
Human   608 EWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQWVDEAKLNQMRREGIRYARIQLCD 672

  Fly   854 NDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYYPGQEVI-NEKNNPVLAETPHYKEKQTILPNPI 917
            |||||:|||:||||:||:||.|:|||:||:||:|..|.. |.::|                    
Human   673 NDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPVVEATQNTESN-------------------- 717

  Fly   918 SHDECGKKTPSKRAHDGRTKKKLIDLDGK------ERRSSESSIDEHPAAGSSSPSQNQEN 972
            |:.:|           |.|.|:.:::|.:      |...:.:.|.....|.||.|..::.|
Human   718 SNMDC-----------GLTGKRELEVDSQCVRIKTESEEACTEIQLLTTASSSFPPASELN 767

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10600NP_001137839.1 None
RSBN1NP_060834.2 Nuclear localization signal. {ECO:0000255} 252..263 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336708705
eggNOG 1 0.900 E1_KOG4425
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 484 1.000 Inparanoid score I1434
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002692
OrthoInspector 1 1.000 T608533
orthoMCL 1 0.900 OOG5_131807
Panther 1 1.100 LDO PTHR13354
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.