DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10600 and Rsbn1l

DIOPT Version :8

Sequence 1:NP_001137839.1 Gene:CG10600 / 35142 FlyBaseID:FBgn0032717 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001129344.1 Gene:Rsbn1l / 311987 RGDID:1308748 Length:824 Species:Rattus norvegicus

Alignment Length:989 Identity:305/989 - (30%)
Similarity:466/989 - (47%) Gaps:251/989 - (25%)


  Fly    62 ARGNASPTTTSAQREATTTITPVEPTAAATTTNGNTLPTQQQQQLQSGDGNANNPTTNARIMLAA 126
            |||   |....:::||...:.| ....:..:.:...:.|::::..:..:|..::.....::...|
  Rat     8 ARG---PVAVLSEKEAFGKLQP-SSRESPGSMSAKKVRTEEKKGPRRVNGEGDSGGNGGQLQPPA 68

  Fly   127 AEEEQAVASSVATTAGAPTAATTTATTT---ALADTTKTSTSTDEKTGKVKRN----SQNTNPMS 184
            |...|:..|..|.:..|..||::.||..   |.:.:...|:::...:..|.|.    |...:...
  Rat    69 APSPQSYGSPAAWSFAARPAASSQATPRGCYAFSASPSVSSASASSSQPVPRKLLVASSLLHAQP 133

  Fly   185 TNVICTPTHSPTPPTEERNHKRKKRDRERDEDKNR-------RSNNHNSSSKDRDKDRDRDKERD 242
            ..|:..|.   |||...:..:.|::   |:::|.|       |..|..:....|||.:|:.||:|
  Rat   134 HRVLLPPV---TPPAAAKPRRPKEK---REKEKRRHGLGGADRDENGEAKPLPRDKIKDKIKEKD 192

  Fly   243 KERDRERERDRNRESSSKSSKEAEHKSSSSRSKEKYHRSDRDREREKERDREKIPSSSSSSSSHS 307
            ||::|||::.:......|.:.:.:....|.:.|.|.:..|...::.|::.::|       ...:.
  Rat   193 KEKERERKKHKVMSEIKKENGDVKIFLKSGKEKPKTNIEDLQIKKVKKKKKKK-------HKENE 250

  Fly   308 NRRRSSDSSRSSQNSSFKSKDPGADPVLPQAVVAALEKQIKVEEVIKKEPVETKQEVDTEPTPVL 372
            .|:|....|:|.|.                                                 :.
  Rat   251 KRKRPKMYSKSIQT-------------------------------------------------IC 266

  Fly   373 SNLIKTEAEIKTESTEKPNKPLVNGEAIAKTRDEVSRQL---NFGDKVSNSKLMPSPAPKSSSGS 434
            |.|:..|        ::..|.::|.    ..:|.:.:.|   |...||.::...|..:.|.....
  Rat   267 SGLLSAE--------DQEAKGILND----NVKDCIGKHLDTKNCDSKVPDNSDFPFVSLKEPRVQ 319

  Fly   435 NSTASNHSSSQSSSSRKSYLSSSSSSSSSNHHKSSSSSSSRHSSSTSRECSKCYKRSKIRRTSVG 499
            |.                                                        ::|    
  Rat   320 ND--------------------------------------------------------LKR---- 324

  Fly   500 VQCLQHAPATGPWQTVQSLPPRPNRKPPAGLENLKYGCYFQVEQYPNGGASIVHLYQHEIDALSP 564
                                          |:.|::.....||..||||||::|.|..|:..|||
  Rat   325 ------------------------------LDTLEFKQLIHVEHQPNGGASVIHAYCSELSCLSP 359

  Fly   565 DEMEELVDEFFEVCFAEDEQGYAHHVMGIVHDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIE 629
            .||....:||..:.|:|:|...|.:|||:||.||.||||.|::.:.|:....||..:||: .|||
  Rat   360 VEMRRFAEEFVGLAFSENESSAAFYVMGVVHGAATYLPDFLDYFSYNFPNSPVKMEILGK-KDIE 423

  Fly   630 TCTMSQYNEQVVRNYCQGTFRYGPLHQISLVGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNS 694
            |.|||.::.||.|.|..||:|.||:.||||||.|.||||.|||:.|..:|.:|||:.|:||...|
  Rat   424 TTTMSNFHAQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKCTLPWGTLS 488

  Fly   695 ILQTDPRQ-SNDGPILWIRAGEQLVPTAELNSKTPLKRQRTRINELRNLQYLPRLSEARETMIED 758
            .|:.:.|: |:||||:|:|.|||::|.|:: .|:|.||:|| .||::|||||||.||.||.:.||
  Rat   489 SLKLESRKDSDDGPIMWVRPGEQMIPVADM-PKSPFKRKRT-TNEIKNLQYLPRTSEPREMLFED 551

  Fly   759 RTKAHADHVGHGHERITTAAVGILKAVHCGQTYSQNRITKDVVAFAAQDFNTMVEMLQLDLHEPP 823
            ||:|||||:|.|.||.||||||:||||||||...|.|:||||:.|.|:||..:|:.:||||||||
  Rat   552 RTRAHADHIGQGFERQTTAAVGVLKAVHCGQRPDQPRVTKDVICFHAEDFLEVVQRMQLDLHEPP 616

  Fly   824 ISQCVQWIEDAKLNQLRREGVRYARIQLCDNDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYY-- 886
            :||||||::|||||||||||:|||||||.||||||:|||::|||:||:||.|:|||:||:.|:  
  Rat   617 LSQCVQWVDDAKLNQLRREGIRYARIQLYDNDIYFIPRNVVHQFKTVSAVCSLAWHVRLKLYHAE 681

  Fly   887 ----------------PGQEVI------NEKNNPVLA-------ETPHYKEKQTILPN----PIS 918
                            |...|:      ...::|||:       |:|..|::..:..|    |::
  Rat   682 DTCHSTVTHEQGIPSGPTSSVLGTHTENQSSSDPVLSDRLHSKYESPQVKQEPVVSLNIKEEPVT 746

  Fly   919 HDECGK-KTPSKRAHDGRTKKKL----------IDLDGKERRSSESSIDEHPAAGS--------- 963
            .....| :||:..  :|::.|..          ||:|.|...::: .:.|....||         
  Rat   747 VTVSAKTRTPNNT--EGKSSKAKSDHVQFSDFHIDMDSKFENTNK-DLKEDLCPGSVQEVDTRQH 808

  Fly   964 ----SSPSQNQENN 973
                |:..::.|||
  Rat   809 SCIPSNQDRSDENN 822



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336709821
eggNOG 1 0.900 E1_KOG4425
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002692
OrthoInspector 1 1.000 T617466
orthoMCL 1 0.900 OOG5_131807
Panther 1 1.100 O PTHR13354
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.790

Return to query results.
Submit another query.