DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10600 and Rsbn1l

DIOPT Version :8

Sequence 1:NP_001137839.1 Gene:CG10600 / 35142 FlyBaseID:FBgn0032717 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001074446.1 Gene:Rsbn1l / 242860 MGIID:3036237 Length:821 Species:Mus musculus

Alignment Length:1038 Identity:314/1038 - (30%)
Similarity:473/1038 - (45%) Gaps:294/1038 - (28%)


  Fly    18 KESTGNVRKPEKKPLEGAVGASKQRETPEKGVNKASAVENNNANARGNASPTTTSAQREATTTIT 82
            ||::|.|:...::| .|::.|.|.| |.||   ||....|....:.||..               
Mouse    18 KEASGKVQPSSREP-PGSMSAKKVR-TEEK---KAPRRVNGEGGSGGNGG--------------- 62

  Fly    83 PVEPTAAATTTNGNTLPTQQQQQLQSGDGNANNPTTNARIMLAAAEEEQAVASSVA-TTAGAPTA 146
                                  |||                      .|:..|..| :.|..|.|
Mouse    63 ----------------------QLQ----------------------PQSFGSPAAWSFAARPAA 83

  Fly   147 ATTTATTTALADTTKTSTSTDEKTGKVKRNSQNTNPMSTNVICTPT--HSP-----TPPTEERNH 204
            ::::.:.:..:.:...|.|:        .::.::.|:...::.||:  |:.     .||......
Mouse    84 SSSSTSRSCYSFSASPSVSS--------ASASSSQPLPRKLLVTPSLLHAQPHRVLLPPVAPPAA 140

  Fly   205 KRKKRDRERDEDKNRRSNNHNSSSKDRDKD-----RDRDKERDKERDRERERDRNRESSSKSSKE 264
            .:.:|.:|:.|.:.||.:...::::|.:.:     ||:.|::.||:|:|||:.:::..|....:.
Mouse   141 AKPRRPKEKREKEKRRQHGLGAAARDENGEAKPLPRDKIKDKIKEKDKEREKKKHKVMSEIKKEN 205

  Fly   265 AEHKSSSSRSKEKYHRSDRDREREKERDREKIPSSSSSSSSHSNRRRSSDSSRSSQNSSFKSKDP 329
            .:.|......|||...:..|.:.:|.:.::|     .....:..|:|....|:|.|.        
Mouse   206 GDVKILLKSGKEKPKTNIEDLQIKKVKKKKK-----KKHKENEKRKRPKMYSKSIQT-------- 257

  Fly   330 GADPVLPQAVVAALEKQIKVEEVIKKEPVETKQEVDTEPTPVLSNLIKTEAEIKTESTEKPNKPL 394
                                                     :.|.|:..|.:             
Mouse   258 -----------------------------------------ICSGLLSAEDQ------------- 268

  Fly   395 VNGEAIAKTRDEVSRQLNFGDKVSNSKLMPSPAPKSSSGSNSTASNHSSSQSSSSRKSYLSSSSS 459
               ||.:...|.|                     |...|.|....|..|....:|...::|....
Mouse   269 ---EAKSILSDNV---------------------KDCIGKNLDTKNCDSKIPDNSDFPFVSLKEP 309

  Fly   460 SSSSNHHKSSSSSSSRHSSSTSRECSKCYKRSKIRRTSVGVQCLQHAPATGPWQTVQSLPPRPNR 524
            ...:|                            :||                             
Mouse   310 RDKNN----------------------------LRR----------------------------- 317

  Fly   525 KPPAGLENLKYGCYFQVEQYPNGGASIVHLYQHEIDALSPDEMEELVDEFFEVCFAEDEQGYAHH 589
                 |:.|.:.....:|..|||||:::|.|.:|:..|||.||:...:||..:.|:|:|...|.:
Mouse   318 -----LDTLAFRQLIHIEHQPNGGAAVIHAYSNELSCLSPMEMQRFAEEFVGLVFSENESSAAFY 377

  Fly   590 VMGIVHDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPL 654
            ||||||.||.||||.|::.:.|:....||..:||: .||||.|||.::.||.|.|..||:|.||:
Mouse   378 VMGIVHGAATYLPDFLDYFSYNFPNSPVKMEILGK-KDIETTTMSNFHAQVKRTYSHGTYRAGPM 441

  Fly   655 HQISLVGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNSILQTDPRQ-SNDGPILWIRAGEQLV 718
            .||||||.|.||||.|||:.|..:|.:|||:.|:||...|.|:.:.|: |:||||:|:|.|||::
Mouse   442 RQISLVGAVDEEVGDYFPEFLDMLEASPFLKCTLPWGTLSSLKLESRKDSDDGPIMWVRPGEQMI 506

  Fly   719 PTAELNSKTPLKRQRTRINELRNLQYLPRLSEARETMIEDRTKAHADHVGHGHERITTAAVGILK 783
            |.|:: .|:|.||:|| .||::|||||||.||.||.:.||||:|||||:|.|.||.||||||:||
Mouse   507 PVADM-PKSPFKRKRT-TNEIKNLQYLPRTSEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLK 569

  Fly   784 AVHCGQTYSQNRITKDVVAFAAQDFNTMVEMLQLDLHEPPISQCVQWIEDAKLNQLRREGVRYAR 848
            ||||||...|.|:||||:.|.|:||..:|:.:||||||||:||||||::|||||||||||:||||
Mouse   570 AVHCGQRPDQPRVTKDVICFHAEDFLEVVQRMQLDLHEPPLSQCVQWVDDAKLNQLRREGIRYAR 634

  Fly   849 IQLCDNDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYYPGQEVINEKNNPVLAETPHYKEKQTIL 913
            |||.||||||:|||::|||:||:||.|:|||:||:.|:..::..:.     .:|:.|.|   .|.
Mouse   635 IQLYDNDIYFIPRNVVHQFKTVSAVCSLAWHVRLKFYHAEEDTCHS-----TSESTHEK---GIA 691

  Fly   914 PNPIS-----HDE--------CGKKTPSK------RAHDG---RTK---------KKLIDLDGKE 947
            ..|.|     |.|        ...|.|||      :...|   |.|         :|:...:..|
Mouse   692 SGPTSSVLGAHTENQASSDSVLSDKLPSKYESQQIKHEPGAALRIKEEPGMAPIPEKIRTPNNTE 756

  Fly   948 RRSSESSIDE------HPAAGSSSPSQNQENNSNSSSQSGASGVSTPKKKS-------SKEDS 997
            .::|::.:|.      |....|:..:.|::...:|...|.::.|.|.:..|       |::||
Mouse   757 GKNSKARLDRAQFSDFHIDMDSAFENTNKDLKEDSCPGSVSNTVDTQQHSSVRSSQDRSEDDS 819



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336708182
eggNOG 1 0.900 E1_KOG4425
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002692
OrthoInspector 1 1.000 T615357
orthoMCL 1 0.900 OOG5_131807
Panther 1 1.100 O PTHR13354
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4253
TreeFam 1 0.960
109.730

Return to query results.
Submit another query.