DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10600 and Rsbn1

DIOPT Version :8

Sequence 1:NP_001137839.1 Gene:CG10600 / 35142 FlyBaseID:FBgn0032717 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001343485.1 Gene:Rsbn1 / 229675 MGIID:2444993 Length:795 Species:Mus musculus

Alignment Length:960 Identity:294/960 - (30%)
Similarity:420/960 - (43%) Gaps:293/960 - (30%)


  Fly    35 AVGASKQ-----RETPEKGVNKASAVENNNANARGNASPTTTSAQ----------REATTTITPV 84
            ||.|.::     :|.|..||:.........|::.|:.......:|          |.:.....|:
Mouse    60 AVAAQEEPDKEGKEKPHVGVSPRGVKRQRRASSGGSQEKRGRPSQDPPLAPPHRRRRSRQHPGPL 124

  Fly    85 EPTAAATTTNGNTLPTQQQQQLQSGDGNANNPTTNARIMLAAAEEEQAVASSVATTAGAPTAATT 149
            .||.||.|..|...|                       :|.......::|.:..|.| ||..|..
Mouse   125 PPTNAAPTVPGPVEP-----------------------LLLPPPPPPSLAPAGPTVA-APLPAPG 165

  Fly   150 TATTTALADTTKTSTSTDEKTGKVKRNSQNTNPMSTNVICTPTHSPTPPTEERNHKRKKRDRERD 214
            |:.....:..|.::..                         |.|        :.||.:       
Mouse   166 TSALFTFSPLTVSAAG-------------------------PKH--------KGHKER------- 190

  Fly   215 EDKNRRSNNHNSSSKDRDKDRDRD-KERDKERDRERE------RDRNRESSSKSSKEAEHK---- 268
                .:.::|..|..|.......| |.:||:.:.||.      :...||::.::.|.....    
Mouse   191 ----HKHHHHRGSDGDPGACVPGDLKHKDKQENGERSGGVPLIKAPKRETADENGKTQRADDFVL 251

  Fly   269 SSSSRSKEKYHRSDRDREREKERDREKIPSSSSSSSSHSNRRRSSDSSRSSQNSSFKSKDPGADP 333
            ....:.|:|.||.|....|.|..::|                                       
Mouse   252 KKIKKKKKKKHREDMRGRRLKMYNKE--------------------------------------- 277

  Fly   334 VLPQAVVAALEKQIKVEEVIKKEPVETKQEVDTEPTPVLSNLIKTEAEIKTESTEKPNKPLVNGE 398
              .|.|.|.|.:       |.||                   |.|:.::.:.|.       ||.|
Mouse   278 --VQTVCAGLTR-------ISKE-------------------ILTQGQLNSTSG-------VNKE 307

  Fly   399 AIAKTRDEVSRQLNFGDKVSNSKLMPSPAPKSSSGSNSTASNHSSSQSSSSRKSYLSSSSSSSSS 463
            :....:||...:||.|       :.....|:   |..:..:.|   |..|.|:::|.:.:..|:.
Mouse   308 SFRYLKDEQLCRLNLG-------MQEYRVPQ---GVQTPFTTH---QEHSIRRNFLKTGTKFSNF 359

  Fly   464 NHHKSSSSSSSRHSSSTSRECSKCYKRSKIRRTSVGVQCLQHAPATGPWQTVQSLPPRPNRKPPA 528
            .|.:..|                                                          
Mouse   360 IHEEHQS---------------------------------------------------------- 366

  Fly   529 GLENLKYGCYFQVEQYPNGGASIVHLYQHEIDALSPDEMEELVDEFFEVCFAEDEQGYAHHVMGI 593
                             ||||.::|.|..|:..|||.|||...:||..:.|:|:|:..|::.:.|
Mouse   367 -----------------NGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAI 414

  Fly   594 VHDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPLHQIS 658
            ||.||.||||.|::.|.|:....||..:||: .||||.|:|.::.||.|.||.||:|.||:.|||
Mouse   415 VHGAAAYLPDFLDYFAFNFPNTPVKMEILGK-KDIETTTISNFHTQVNRTYCCGTYRAGPMRQIS 478

  Fly   659 LVGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNSILQTDPR-QSNDGPILWIRAGEQLVPTAE 722
            |||.|.||||.|||:.|..:|.:|||:.|:||...|.||...| ||:||||:|:|.|||::|||:
Mouse   479 LVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLQLQCRSQSDDGPIMWVRPGEQMIPTAD 543

  Fly   723 LNSKTPLKRQRTRINELRNLQYLPRLSEARETMIEDRTKAHADHVGHGHERITTAAVGILKAVHC 787
            : .|:|.||:|: :||::|||||||.||.||.:.||||:|||||||.|.:..:|||||:||||..
Mouse   544 M-PKSPFKRRRS-MNEIKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQF 606

  Fly   788 GQTYSQNRITKDVVAFAAQDFNTMVEMLQLDLHEPPISQCVQWIEDAKLNQLRREGVRYARIQLC 852
            |:...|.||||||:.|.|:||..:|:.|||||||||:||||||:::|||||:||||:||||||||
Mouse   607 GEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQWVDEAKLNQMRREGIRYARIQLC 671

  Fly   853 DNDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYYPGQEVINEKNNPVLAETPHYKEKQTILPNPI 917
            ||||||:|||:||||:||:||.|:|||:||:||:|            :.||....|..       
Mouse   672 DNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHP------------VVETAQNTESN------- 717

  Fly   918 SHDECGKKTPSKRAHDGRTKKKLIDLDGKERRSSESSIDEHPAAGSSSPS 967
            |:.:||.:..|:..              :.:..||....|.....::|||
Mouse   718 SNMDCGLEVDSQCV--------------RIKTESEERCTEMQLLTTASPS 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10600NP_001137839.1 None
Rsbn1NP_001343485.1 Nuclear localization signal. {ECO:0000255} 252..263 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336711172
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002692
OrthoInspector 1 1.000 T615357
orthoMCL 1 0.900 OOG5_131807
Panther 1 1.100 LDO PTHR13354
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4253
TreeFam 1 0.960
98.830

Return to query results.
Submit another query.