DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10600 and LOC100330644

DIOPT Version :8

Sequence 1:NP_001137839.1 Gene:CG10600 / 35142 FlyBaseID:FBgn0032717 Length:1406 Species:Drosophila melanogaster
Sequence 2:XP_009295213.1 Gene:LOC100330644 / 100330644 ID: Length:793 Species:Danio rerio

Alignment Length:825 Identity:282/825 - (34%)
Similarity:412/825 - (49%) Gaps:130/825 - (15%)


  Fly   229 KDRDKDRDRDKERDKERDRERER-----DRNRESSSKSSKEAE---HKSSSSRSKEKY---HRSD 282
            |..:|.||...:..||:.::::|     |..||.|.|.:|:.:   |:.|....:::.   |:..
Zfish    42 KVEEKSRDSFDKATKEKKKKKKRECSPPDDKRERSEKEAKKIKLHHHQHSHQHEQQRAHPPHQQQ 106

  Fly   283 RDREREKERDREKIPSSSSSSSSHSNRRRSSDSSRSSQNSSFKSKDPGADPVLPQAVV----AAL 343
            .::.|...:::..:|        |.:...       ..|.|.|.:.|   ||.|...|    .|.
Zfish   107 NNQARNFSKEQALVP--------HRHHHH-------HHNHSSKKEVP---PVWPPRKVTPAAGAA 153

  Fly   344 EKQIKVEEVIKKEPVETKQEVDTEPTPVLSNLIKTEAEIKTESTEKPNKPLVNGEAIAKTRDEVS 408
            ...:..:.|....|:.|...:.......|:|..|   .|:.::..||.|.  |.||..|.     
Zfish   154 VAHVPQKTVQPPSPLFTFTPLKVAKAKPLNNKPK---HIEKDAKLKPKKE--NAEANVKV----- 208

  Fly   409 RQLNFGDKVSNSKLMPSPAPKSSSGSNSTASNHSSSQSSSSRKSYLSSSSSSSSSNHHKSSSSSS 473
                       .:......|...:|...|...: ..:....:|.:...........|||...:..
Zfish   209 -----------GECKKKKEPHGENGKTQTLEEY-LLKKKKKKKRHREDERGKKLRMHHKEVQTVC 261

  Fly   474 SRHSSSTSRECSKCYKRSKIRRTSVGVQCLQHAPATGPWQTVQSLPPRPNRKP----------PA 528
            |..:...|.:             .||...::.....|.:..     |:..:||          .:
Zfish   262 SGDTPPLSED-------------PVGHAYIKEEKDLGEYDA-----PKEAKKPFLTHQDHYIRSS 308

  Fly   529 GLE-NLKYGCYFQVEQYPNGGASIVHLYQHEIDALSPDEMEELVDEFFEVCFAEDEQGYAHHVMG 592
            .|: |..:......|:.||||||::|.|..|:..|.|.|.|:...||.::.|||..:|.|.:.:.
Zfish   309 WLQTNTCFSRLIHEEKQPNGGASVLHAYADELSLLRPGETEKFAQEFMKLAFAEQPKGAARYALA 373

  Fly   593 IVHDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPLHQI 657
            :||.||.||||.|::.|.|:....||..:||: .||||.|::.::.||.|.||.||:|.||:.||
Zfish   374 VVHGAAAYLPDFLDYFAFNFPNTPVKVEILGK-KDIETTTIANFHTQVSRTYCCGTYRAGPMRQI 437

  Fly   658 SLVGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNSILQTDPR-QSNDGPILWIRAGEQLVPTA 721
            ||||.|.||||.:||:.|..:|.:|||:.|:||...|.|:.|.| ||:||||:|:|.|||:||||
Zfish   438 SLVGAVDEEVGDFFPEFLDMLEESPFLKMTLPWGSLSSLKLDCRSQSDDGPIMWVRPGEQMVPTA 502

  Fly   722 ELNSKTPLKRQRTRINELRNLQYLPRLSEARETMIEDRTKAHADHVGHGHERITTAAVGILKAVH 786
            :: .|:|.||:|: :||::||.||||.||.||.:.||||:|||||||...:..:|||||:|||||
Zfish   503 DM-PKSPFKRRRS-MNEIKNLHYLPRASEPREVLFEDRTRAHADHVGQSFDWQSTAAVGVLKAVH 565

  Fly   787 CGQTYS-QNRITKDVVAFAAQDFNTMVEMLQLDLHEPPISQCVQWIEDAKLNQLRREGVRYARIQ 850
            .|:..| |.|||||||.|.|:|||.:|:.|||||:|||:||||||::|||||||||||:||.|:|
Zfish   566 FGECRSDQPRITKDVVCFHAEDFNDVVQRLQLDLYEPPVSQCVQWVDDAKLNQLRREGIRYVRMQ 630

  Fly   851 LCDNDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYYPGQEVINEKNNPVLAETPHYKEKQ---TI 912
            |||:||||:|||:||||:||:||.|:|||:||:||:..:|.         .|....|.|.   |.
Zfish   631 LCDDDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHSEEEE---------EEAKDVKTKDLCTTS 686

  Fly   913 LPNPISHDECGKKTPSKRAHDGRTKKKLIDLDGKERRSSESSIDEHPAAGSSSPSQNQENNSNSS 977
            .|.|:..|.  |.|...|......:..:..:|        ..:.:.||    :|.:..:......
Zfish   687 CPPPVHPDT--KVTSCARLQTDAAQGGVAKMD--------ELVFQRPA----TPPREPQPAPPQP 737

  Fly   978 SQSGASGVSTPKKKSSKEDSKIDMRKMVLEHKYKLTKAAVTETPE 1022
            ::|..:..:.|..:||               .:..|....:.|||
Zfish   738 AKSARTVYAAPCSESS---------------PFPATSPLCSSTPE 767



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336705664
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13354
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.