DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10600 and rsbn1

DIOPT Version :8

Sequence 1:NP_001137839.1 Gene:CG10600 / 35142 FlyBaseID:FBgn0032717 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001106425.2 Gene:rsbn1 / 100127593 XenbaseID:XB-GENE-5866553 Length:687 Species:Xenopus tropicalis

Alignment Length:825 Identity:267/825 - (32%)
Similarity:379/825 - (45%) Gaps:203/825 - (24%)


  Fly   212 ERDEDKNRRSNNHNSSSKDRDKDRDRDKERDKERDRERERDRNRESSSKSSKEAEHKSSSSRSKE 276
            |||:.|..|.......|...:|.|.:..|.....|.|:|..:.     |...:..|.....|...
 Frog    11 ERDKAKVGRKKKRREGSPSGEKKRKKKGEGGGGEDGEKEAKKR-----KLGNDTHHSCHHHRHHH 70

  Fly   277 KYHRS--------------------------------------DRDREREKERDREKIPSSSSSS 303
            .:||.                                      :|.:|:.|.:.:.|..:....|
 Frog    71 HHHRHHHHHHSKEELLLRPPPPTLGVPQSITPITQALFTLSQLERPKEKVKRKHKTKKENGEGGS 135

  Fly   304 SSHSNRRRSSDSSRSSQNSSFKSKDPGADPVLPQAVVAALEKQIKVEEVIKKEPVETKQEVDTEP 368
            ...:.::...|.:..||.                 |:...|....::::.||:..:.:.::....
 Frog   136 PLRAVKKELPDENGKSQR-----------------VIKHEEDSFLIKKIKKKKKKKHRDDLRGRK 183

  Fly   369 TPVLSNLIKTEAEIKTEST-----EKPNKPLVNGEAIAKTRDEVSRQLNFGD---KVSNSKLMPS 425
            ..:.:..::|.....|..|     ||.....||.|:....:||...:.:.|.   :|.....|| 
 Frog   184 LKMYNKEVQTLCAGLTRITQDVLDEKDAGIEVNSESCRYLQDEKLCRSDLGTEEYRVPQEVQMP- 247

  Fly   426 PAPKSSSGSNSTASNHSSSQSSSSRKSYLSSSSSSSSSNHHKSSSSSSSRHSSSTSRECSKCYKR 490
                           .:|.|....|.:.|...|..|...|.::.|                    
 Frog   248 ---------------FASHQEHCIRTNTLDRGSKFSRLMHEENQS-------------------- 277

  Fly   491 SKIRRTSVGVQCLQHAPATGPWQTVQSLPPRPNRKPPAGLENLKYGCYFQVEQYPNGGASIVHLY 555
                                                                   ||||.::|.|
 Frog   278 -------------------------------------------------------NGGAPVLHAY 287

  Fly   556 QHEIDALSPDEMEELVDEFFEVCFAEDEQGYAHHVMGIVHDAARYLPDLLEHMAENYSTLTVKAG 620
            ..|:..|||.|||...:||.|..|.|:::..|::.:.:||.||.||||.|::.|.|:....||..
 Frog   288 MDELSFLSPVEMERFAEEFLERTFNENDKSAAYYALAVVHGAAAYLPDFLDYFAFNFPNTPVKME 352

  Fly   621 VLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPLHQISLVGKVHEEVGGYFPDLLGRIEMNPFLR 685
            :||: .||||.|::.::.||.|.||.||:|.||:.||||||.|.||||.:||:.|..:|.:|||:
 Frog   353 ILGK-KDIETTTIANFHTQVSRTYCCGTYRAGPMRQISLVGAVDEEVGDFFPEFLDMLEESPFLK 416

  Fly   686 KTMPWACNSILQTDPR-QSNDGPILWIRAGEQLVPTAELNSKTPLKRQRTRINELRNLQYLPRLS 749
            .|:||...|.|:...| ||:||||:|:|.|||::|||:: .|:|.||:|: :||::|||||||.|
 Frog   417 MTLPWGTMSTLRLQCRSQSDDGPIMWVRPGEQMIPTADM-PKSPFKRRRS-MNEIKNLQYLPRTS 479

  Fly   750 EARETMIEDRTKAHADHVGHGHERITTAAVGILKAVHCGQTYSQNRITKDVVAFAAQDFNTMVEM 814
            |.||.:.||||:|||||||.|.:..:|||||:||||..|:...|.||||||:.|.|:||:.:|:.
 Frog   480 EPREVLFEDRTRAHADHVGQGFDWESTAAVGVLKAVQFGEWSDQPRITKDVICFHAEDFSHVVQR 544

  Fly   815 LQLDLHEPPISQCVQWIEDAKLNQLRREGVRYARIQLCDNDIYFLPRNIIHQFRTVTAVTSVAWH 879
            |||||||||:||||||:::|||||:||||:||||||||||||||:|||:||||:||:||.|:|||
 Frog   545 LQLDLHEPPVSQCVQWVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWH 609

  Fly   880 LRLRQYYPGQEVINEKNNPVLAETPHYKEKQTILPNPISHDECGKKTPSKRAHDGRTKKKLIDLD 944
            :||:||...:|      :|..||..|..|  |..|.......|.|                    
 Frog   610 IRLKQYSANKE------DPQPAEKDHGSE--TSAPKDNFETACFK-------------------- 646

  Fly   945 GKERRSSESSIDEHPAAGSSSP--------SQNQENNSNSSSQSG 981
                ...|.::.....|.|.:|        ||.|:...|....||
 Frog   647 ----MEDEDTLITAAQAPSLAPPIPSQRLESQPQQTQGNPYHTSG 687



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C336713112
eggNOG 1 0.900 E1_KOG4425
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002692
OrthoInspector 1 1.000 T600455
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4253
TreeFam 1 0.960
87.730

Return to query results.
Submit another query.