DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and Prdm16

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_006539234.1 Gene:Prdm16 MGIID:1917923 Length:1277 Species:Mus musculus

Alignment Length:677 Identity:180/678 (27%)
Similarity:251/678 (37%) Gaps:231/678 (34%)


  Fly     5 DHSPRKMLPSPKQGCVYPALGLIPTSYISHVPYDLASSASVAATSSSSTSPTTTSATTTGRLQHQ 69
            :|:....||||...   |||.|:               ::|:.:|..:|:.|.:.....|||:..
Mouse   542 NHAQDAKLPSPLGN---PALPLV---------------SAVSNSSQGATAATGSEEKFDGRLEDA 588

  Fly    70 HSHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEK 134
            ::.          |.|.||               .|:.|....||.|:..   .::|........
Mouse   589 YAE----------KVKNRS---------------PDMSDGSDFEDINTTT---GTDLDTTTGTGS 625

  Fly   135 ELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGG--------------------------GG 173
            :|:::  ..|..|.|.|..:.:......|||....|.                          ..
Mouse   626 DLDSD--LDSDRDKGKDKGKPVESKPEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTAS 688

  Fly   174 GGGGGG------------GP------------------------PNAPPLTPPQCSIPAVHPTLL 202
            |..|..            ||                        ||.|....|.......|..|:
Mouse   689 GAAGDSIKAIASIAEKYFGPGFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLV 753

  Fly   203 EAMTK-----------------NLPLQYRNVFAGVLPGKV----------------NSPAASSSP 234
            :|..|                 :|..:.:.....:|..||                .|.|.:|..
Mouse   754 KAEPKSPRDALKVGGPSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQN 818

  Fly   235 TGADFPFRHPL-------------KKCELTWPPPTEQLQLELPHPNP------------------ 268
            .|...|.::.:             |.|....|   :|..|....|:|                  
Mouse   819 GGGREPRKNHVYGERKPGVSEGLPKVCPAQLP---QQPSLHYAKPSPFFMDPIYSRVEKRKVADP 880

  Fly   269 ---------KLSPVLPHPQLQDYQT---RRKNKARTAATGGNATPNLP----------------- 304
                     :.||:|.|||:...:|   :.::.|...|..|::...||                 
Mouse   881 VGVLKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPI 945

  Fly   305 -QRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPF 368
             ::.|:||||::|||:||||||||||||||||||||:||||:||||||||||||||||||||:||
Mouse   946 LRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPF 1010

  Fly   369 KCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPT------------EES 421
            ||.:|.|||||||||||||||||.:...:|..|||... | :.....:||            |:|
Mouse  1011 KCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTN-H-LGTSASSPTSESDNHALLDEKEDS 1073

  Fly   422 YFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSHEEA-----DHA 481
            ||.|||:|:  ...:..|...:.....:.|...|......|:.:...|......||.     |..
Mouse  1074 YFSEIRNFI--ANSEMNQASTRMDKRPEIQDLDSNPPCPGSASAKPEDVEEEEEEELEEEDDDSL 1136

  Fly   482 PATSTADTAAPSSSRD---QEEEDSQP 505
            ...|..||.:|:....   ::|||.:|
Mouse  1137 AGKSQEDTVSPTPEPQGVYEDEEDEEP 1163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 51/81 (63%)
zf-C2H2 311..333 CDD:278523 19/22 (86%)
C2H2 Zn finger 313..333 CDD:275368 17/20 (85%)
zf-H2C2_2 325..349 CDD:290200 22/24 (92%)
C2H2 Zn finger 341..362 CDD:275368 20/21 (95%)
zf-H2C2_2 353..377 CDD:290200 20/24 (83%)
zf-C2H2 368..390 CDD:278523 19/22 (86%)
C2H2 Zn finger 370..390 CDD:275368 17/20 (85%)
Prdm16XP_006539234.1 SET 84..210 CDD:214614
C2H2 Zn finger 233..253 CDD:275368
COG5048 <277..417 CDD:227381
zf-C2H2 283..305 CDD:278523
C2H2 Zn finger 285..305 CDD:275368
zf-H2C2_2 297..321 CDD:290200
zf-C2H2 311..333 CDD:278523
C2H2 Zn finger 313..333 CDD:275368
zf-C2H2 339..360 CDD:278523
C2H2 Zn finger 341..359 CDD:275368
zf-C2H2 368..390 CDD:278523
C2H2 Zn finger 370..390 CDD:275368
zf-C2H2_8 371..452 CDD:292531
zf-C2H2 396..418 CDD:278523
C2H2 Zn finger 398..418 CDD:275368
C2H2 Zn finger 427..445 CDD:275368
COG5048 933..>1005 CDD:227381 49/72 (68%)
zf-C2H2 953..975 CDD:278523 19/22 (86%)
C2H2 Zn finger 955..975 CDD:275368 17/20 (85%)
zf-H2C2_2 967..991 CDD:290200 22/24 (92%)
zf-C2H2 981..1004 CDD:278523 21/23 (91%)
C2H2 Zn finger 983..1004 CDD:275368 20/21 (95%)
zf-C2H2 1010..1032 CDD:278523 19/22 (86%)
C2H2 Zn finger 1012..1032 CDD:275368 17/20 (85%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BAJ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D254483at33208
OrthoFinder 1 1.000 FOG0001415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.