| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001102987.1 | Gene: | Zbtb32 / 688845 | RGDID: | 1584121 | Length: | 483 | Species: | Rattus norvegicus | 
| Alignment Length: | 354 | Identity: | 82/354 - (23%) | 
|---|---|---|---|
| Similarity: | 131/354 - (37%) | Gaps: | 67/354 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    79 NHHA------KGKRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKE-- 135 
  Fly   136 -----LNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIP 195 
  Fly   196 AV--HPTLLEA--MTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPF-----RHP--LKKCE 249 
  Fly   250 LTWPPPTEQLQLELPHPNP--------KLSPVLPHPQLQDY---------QTRRKNKARTAATGG 297 
  Fly   298 NATPNLPQRNKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361 
  Fly   362 HNKERPFKCEICERCFGQQTNLDRHLKKH 390  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 22/63 (35%) | 
| zf-C2H2 | 311..333 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 5/20 (25%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 5/23 (22%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 3/21 (14%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 3/19 (16%) | ||
| Zbtb32 | NP_001102987.1 | BTB_POZ | 13..112 | CDD:365784 | |
| COG5048 | <272..>418 | CDD:227381 | 44/157 (28%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 398..418 | CDD:275368 | 5/21 (24%) | ||
| C2H2 Zn finger | 425..445 | CDD:275368 | 3/19 (16%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||