DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and Zbtb32

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001102987.1 Gene:Zbtb32 RGDID:1584121 Length:483 Species:Rattus norvegicus

Alignment Length:354 Identity:82/355 (23%)
Similarity:131/355 (37%) Gaps:67/355 (19%)


  Fly    79 NHHA------KGKRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKE-- 135
            ||.|      ||.::|.|.:..:..|....:.    |.|.|:.:|.......|...|..:..|  
  Rat   117 NHEAGLDPGWKGHQQSEFMRSSERGLGAPAER----QTPEEESSSEREQETPEEHKAPGESPEMA 177

  Fly   136 -----LNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIP 195
                 :..:..|.|.|.:|:..:......:..|.|...|......|      .:.||:||...:.
  Rat   178 GGRARMRGSEEALSPASMGYRGAETKQAEVMRGRASHRGSEESLRG------CSSPLSPPGSLLT 236

  Fly   196 AV--HPTLLEA--MTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPF-----RHP--LKKCE 249
            ::  .|...||  :.:..|..:..:   :.|.:..:|.:.|:|..|.:..     |.|  |..|:
  Rat   237 SLIPRPWWAEAPWLGEGQPALWSIL---LWPSRYGAPFSHSTPITAAWQVWPQDQRIPLTLNHCK 298

  Fly   250 LTWPPPTEQLQLELPHPNP--------KLSPVLPHPQLQDY---------QTRRKNKARTAATGG 297
            ..|    .:.||....|.|        ||||.......|.|         |.||.|      ...
  Rat   299 GLW----SENQLASSSPTPGSFPQGTEKLSPWEAEESGQGYTGTLATCVSQERRLN------CPS 353

  Fly   298 NATPNLPQRNKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361
            :..|.||...:.| |:|..|||.|.....:..|.|.||||:|:.|..|.:.....|.:.:|:|. 
  Rat   354 HQHPPLPSPARSRPYSCSVCGKRFSLKHQMETHYRVHTGEKPFSCSLCPQRSRDFSAMTKHLRT- 417

  Fly   362 HNKERPFKCEICERCFGQQTNLDRHLKKH 390
             :...|::|.:|........::..|::.|
  Rat   418 -HGAAPYRCPLCRAGCPSLASMQAHMRGH 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 22/64 (34%)
zf-C2H2 311..333 CDD:278523 8/22 (36%)
C2H2 Zn finger 313..333 CDD:275368 7/20 (35%)
zf-H2C2_2 325..349 CDD:290200 9/24 (38%)
C2H2 Zn finger 341..362 CDD:275368 5/21 (24%)
zf-H2C2_2 353..377 CDD:290200 5/24 (21%)
zf-C2H2 368..390 CDD:278523 3/22 (14%)
C2H2 Zn finger 370..390 CDD:275368 3/20 (15%)
Zbtb32NP_001102987.1 BTB 23..109 CDD:279045
BTB 30..112 CDD:197585
COG5048 <272..>418 CDD:227381 44/158 (28%)
zf-C2H2 368..390 CDD:278523 8/22 (36%)
C2H2 Zn finger 370..390 CDD:275368 7/20 (35%)
zf-H2C2_2 383..404 CDD:290200 9/21 (43%)
C2H2 Zn finger 398..418 CDD:275368 5/22 (23%)
C2H2 Zn finger 425..445 CDD:275368 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.