DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and PRDM16

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_071397.3 Gene:PRDM16 HGNCID:14000 Length:1276 Species:Homo sapiens

Alignment Length:697 Identity:184/698 (26%)
Similarity:256/698 (37%) Gaps:260/698 (37%)


  Fly    20 VYPALGLIP-----TSYISH-----VPYDLASSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQ 74
            :||...|:|     .|.::|     :|..|.:.|....::.|::|..||:|...           
Human   522 LYPRPPLLPPTSLLKSPLNHTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGP----------- 575

  Fly    75 HQTLNHHAKGKRRSSFDQPLDLRLAHKRKT---DLVDQGPMEDENSNLIMFASELAVAQQKEKEL 136
                        ...|:..|:.....|.||   |:.|....||.|:..   .::|........:|
Human   576 ------------EEKFESRLEDSCVEKLKTRSSDMSDGSDFEDVNTTT---GTDLDTTTGTGSDL 625

  Fly   137 NNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPPNAP------PL-------- 187
            :        :|:..|..       ::.|.|....|....|||..||.||      |:        
Human   626 D--------SDVDSDPD-------KDKGKGKSAEGQPKFGGGLAPPGAPNSVAEVPVFYSQHSFF 675

  Fly   188 TPPQ-----------CSIPAV--------HPTLLEAMTKNL-PLQYRNVFA-GVLPG-------- 223
            .||.           .||.|:        .|..:....|.| .|.|.:.|. ..||.        
Human   676 PPPDEQLLTATGAAGDSIKAIASIAEKYFGPGFMGMQEKKLGSLPYHSAFPFQFLPNFPHSLYPF 740

  Fly   224 ----------------------KVNSPAA-----------------------SSSPTGADFPF-- 241
                                  ||..|:|                       |:..:|.:.|.  
Human   741 TDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPKDVKPILPMPKGPSAPASGEEQPLDL 805

  Fly   242 --------------RHPLKK-----------------CELTWPPPTEQLQLELPHPNP------- 268
                          |.|.|.                 |....|   :|..|....|:|       
Human   806 SIGSRARASQNGGGREPRKNHVYGERKLGAGEGLPQVCPARMP---QQPPLHYAKPSPFFMDPIY 867

  Fly   269 --------------------KLSPVLPHPQLQDYQT---RRKNKARTAATGGNATPNLP------ 304
                                :.||:|.|||:...:|   :.::.|...|..|::...||      
Human   868 SRVEKRKVTDPVGALKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNF 932

  Fly   305 ------------QRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRH 357
                        ::.|:||||::|||:||||||||||||||||||||:||||:||||||||||||
Human   933 RSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH 997

  Fly   358 VRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPT---- 418
            ||||||||:||||.:|.|||||||||||||||||.:...:|...||... | :.....:||    
Human   998 VRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHENAPVSQHPGVLTN-H-LGTSASSPTSESD 1060

  Fly   419 --------EESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCS---------- 465
                    |:|||.|||:|:......|...:.:::.|.|       ....|:.|.          
Human  1061 NHALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQ-------IVDGSAQCPGLASEKQEDV 1118

  Fly   466 SSRDTPTSSHEEADHAPATSTADTAAPS---SSRDQEEEDSQPIMEL 509
            ...|......::.|.....|..||.:|:   .:..::|||.:|...|
Human  1119 EEEDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASL 1165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 51/81 (63%)
zf-C2H2 311..333 CDD:278523 19/22 (86%)
C2H2 Zn finger 313..333 CDD:275368 17/20 (85%)
zf-H2C2_2 325..349 CDD:290200 22/24 (92%)
C2H2 Zn finger 341..362 CDD:275368 20/21 (95%)
zf-H2C2_2 353..377 CDD:290200 20/24 (83%)
zf-C2H2 368..390 CDD:278523 19/22 (86%)
C2H2 Zn finger 370..390 CDD:275368 17/20 (85%)
PRDM16NP_071397.3 SET 84..209 CDD:214614
C2H2 Zn finger 283..303 CDD:275368
zf-H2C2_2 295..319 CDD:290200
C2H2 Zn finger 311..331 CDD:275368
zf-C2H2 337..358 CDD:278523
C2H2 Zn finger 339..357 CDD:275368
zf-C2H2 366..388 CDD:278523
C2H2 Zn finger 368..388 CDD:275368
zf-C2H2_8 369..450 CDD:292531
zf-C2H2 394..416 CDD:278523
C2H2 Zn finger 396..416 CDD:275368
C2H2 Zn finger 425..443 CDD:275368
Interaction with CTBP1, CTBP2 and ZNF516. {ECO:0000250|UniProtKB:A2A935} 679..1038 113/362 (31%)
Mediates interaction with SKI and regulation of TGF-beta signaling. {ECO:0000269|PubMed:19049980} 739..1276 132/440 (30%)
COG5048 931..>1083 CDD:227381 88/154 (57%)
zf-C2H2 951..973 CDD:278523 19/22 (86%)
C2H2 Zn finger 953..973 CDD:275368 17/20 (85%)
zf-H2C2_2 965..989 CDD:290200 22/24 (92%)
zf-C2H2 979..1002 CDD:278523 21/23 (91%)
C2H2 Zn finger 981..1002 CDD:275368 20/21 (95%)
zf-C2H2 1008..1030 CDD:278523 19/22 (86%)
C2H2 Zn finger 1010..1030 CDD:275368 17/20 (85%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BAJ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D254483at33208
OrthoFinder 1 1.000 FOG0001415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.