DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and si:dkeyp-68b7.7

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_005171531.2 Gene:si:dkeyp-68b7.7 ZFINID:ZDB-GENE-070912-672 Length:690 Species:Danio rerio

Alignment Length:360 Identity:77/361 (21%)
Similarity:122/361 (34%) Gaps:133/361 (37%)


  Fly    41 SSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTD 105
            ||.|.|.:..:|..|.|          |..|.||..|                     ||.::| 
Zfish   403 SSVSDALSLLASHPPKT----------HTQSLQQGVT---------------------AHDQET- 435

  Fly   106 LVDQGPMED---ENSNLIMFASELAV----------------AQQKEKELNNNHIAASLADLGFD 151
            |:...||.:   |...||..|.||.:                .:::|:||:...:...:..:...
Zfish   436 LMLTSPMMNVVSEEKPLIPHAPELQLQPLKREDPASRAAPHAEEEEEEELSGLELQMKIEQVEEF 500

  Fly   152 MSRKMLRALREGGAGGGGGGGGGGGGGGGPPNA------------PPLTPPQC---SIPAVHPTL 201
            :.||:  ::.:|                   |:            ..|..|:.   |.|..|..:
Zfish   501 VDRKL--SIHDG-------------------NSQIWSSQKDFQHHQSLAEPESHAQSFPDAHAMM 544

  Fly   202 LEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHP 266
            :|.             :|.|...|..   :......||......:...:     ::...|...||
Zfish   545 MED-------------SGALSASVQE---NDRNNDCDFNLLQSHEHSSV-----SDTFSLSASHP 588

  Fly   267 NPKLSPVLPHPQ-LQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHL 330
             ||     .|.| ||..:.:|                ||...|. :.|:.|||.|.:...|..|.
Zfish   589 -PK-----THTQSLQQGEDQR----------------LPTSLKP-FRCEECGKSFMQRTKLITHG 630

  Fly   331 RTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKE 365
            |.||||:|::|::|.:.||...|..||:| :|.::
Zfish   631 RVHTGEKPFRCRFCGKMFSRQDNCLRHMR-LHGRQ 664

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/63 (40%)
zf-C2H2 311..333 CDD:278523 8/22 (36%)
C2H2 Zn finger 313..333 CDD:275368 8/20 (40%)
zf-H2C2_2 325..349 CDD:290200 11/24 (46%)
C2H2 Zn finger 341..362 CDD:275368 8/21 (38%)
zf-H2C2_2 353..377 CDD:290200 5/14 (36%)
zf-C2H2 368..390 CDD:278523
C2H2 Zn finger 370..390 CDD:275368
si:dkeyp-68b7.7XP_005171531.2 COG5048 <431..>661 CDD:227381 63/297 (21%)
zf-C2H2 611..633 CDD:278523 8/22 (36%)
C2H2 Zn finger 613..633 CDD:275368 8/20 (40%)
Zf_RING 632..>671 CDD:293349 14/35 (40%)
C2H2 Zn finger 641..661 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.