DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and ZNF580

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001156895.1 Gene:ZNF580 HGNCID:29473 Length:172 Species:Homo sapiens

Alignment Length:214 Identity:61/215 (28%)
Similarity:80/215 (37%) Gaps:54/215 (25%)


  Fly   185 PPLTP-PQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFP-----FRH 243
            ||..| |:.|.|       |||....|.      |...| |...|  ||:|:.|..|     .||
Human     5 PPRPPHPRSSSP-------EAMDPPPPK------APPFP-KAEGP--SSTPSSAAGPRPPRLGRH 53

  Fly   244 PLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNK 308
            .|  .:....|.|..:|||.....|        ||.:                  |.|..|...|
Human    54 LL--IDANGVPYTYTVQLEEEPRGP--------PQRE------------------APPGEPGPRK 90

  Fly   309 DRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKER--PFKCE 371
            . |:|..|.:||.....|..|..:|:..:|:.|..|.::|..||:|.|| |..|....  |..|.
Human    91 G-YSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRH-RATHRARAGPPHTCP 153

  Fly   372 ICERCFGQQTNLDRHLKKH 390
            :|.|.|.....|.:|::.|
Human   154 LCPRRFQDAAELAQHVRLH 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 22/63 (35%)
zf-C2H2 311..333 CDD:278523 7/22 (32%)
C2H2 Zn finger 313..333 CDD:275368 6/20 (30%)
zf-H2C2_2 325..349 CDD:290200 7/24 (29%)
C2H2 Zn finger 341..362 CDD:275368 9/21 (43%)
zf-H2C2_2 353..377 CDD:290200 9/26 (35%)
zf-C2H2 368..390 CDD:278523 6/22 (27%)
C2H2 Zn finger 370..390 CDD:275368 6/20 (30%)
ZNF580NP_001156895.1 C2H2 Zn finger 94..114 CDD:275368 6/20 (30%)
zf-C2H2 120..142 CDD:306579 9/23 (39%)
C2H2 Zn finger 122..142 CDD:275368 9/21 (43%)
C2H2 Zn finger 152..172 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.