DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and mecom

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017206701.1 Gene:mecom ZFINID:ZDB-GENE-050208-123 Length:1257 Species:Danio rerio

Alignment Length:545 Identity:159/546 (29%)
Similarity:224/546 (41%) Gaps:155/546 (28%)


  Fly    21 YPALGLIP------TSYISHVPYDLASSASVAATSSSSTSPTTTSATTTGRLQHQH--------- 70
            :||.||:|      |:....|...:.:.||:|.....||..........|.|.:..         
Zfish   660 FPAPGLLPPSLDEQTAVSGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGALPYPSMFPLSFFPA 724

  Fly    71 ---------SHQQHQTLNHHAKGKRRS-----------SFDQPLDLRLAHKRKTDLVDQGPMEDE 115
                     ..:|.:...|  ||:..|           :.:.|.||....|.:.......|::.|
Zfish   725 FSPSVYPFPEREQLRPPGH--KGEPESPPVESKKPQGRNAESPFDLTTKRKEERLAATCAPVKPE 787

  Fly   116 NSNLIMFASELAVAQQKEKELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGG 180
            .|                      |:.::..|...|:|           .|....|....|....
Zfish   788 AS----------------------HVQSTNQDQPLDLS-----------LGRRNRGKSERGEEIK 819

  Fly   181 PPNA---------PPLTPPQCSIPAVHPTLLEAMTK------NLPLQYRNVFAGVLPGKVNSPAA 230
            ..:|         ||.|.|........|..::.:.:      |.|.:       ||..|...|| 
Zfish   820 KSSAFSEERVEPEPPKTDPSLQHARPMPFFMDPIYRVEKRKMNDPFE-------VLKDKYMRPA- 876

  Fly   231 SSSPTGADFP-FRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPH--------PQLQDYQTRR 286
               |.....| ||.|.::   ||....|.:..:|    ...|.:.|.        |.:.|::...
Zfish   877 ---PGFLFHPQFRMPDQR---TWMSAIENMAEKL----ESFSSLKPDGGDIMRSVPSMFDFRAPP 931

  Fly   287 KNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSIS 351
            .....|          |.::.|:||||::|||: |||||||||||||||||||:||||:||||||
Zfish   932 TTLPET----------LLRKGKERYTCRYCGKIXPRSANLTRHLRTHTGEQPYRCKYCDRSFSIS 986

  Fly   352 SNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCEN 416
            ||||||:|||||||:||||.:|:|||||||||||||||||:..::.:|:|.....:.......|:
Zfish   987 SNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLAGTAMSSPRSELDSSSAILED 1051

  Fly   417 PTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSHEEADHA 481
             .|:|||.|||:|:                       .:||.:|:|. |.|.:....||.:.|.|
Zfish  1052 -KEDSYFNEIRNFI-----------------------SNTARNATSP-SQSEEGLNGSHFDGDKA 1091

  Fly   482 PATSTADTAAPSSSRDQEEEDSQPI 506
                    .:...|||.:||:.:.:
Zfish  1092 --------LSGQGSRDLDEEEGEEL 1108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 48/63 (76%)
zf-C2H2 311..333 CDD:278523 18/22 (82%)
C2H2 Zn finger 313..333 CDD:275368 16/20 (80%)
zf-H2C2_2 325..349 CDD:290200 22/24 (92%)
C2H2 Zn finger 341..362 CDD:275368 19/21 (90%)
zf-H2C2_2 353..377 CDD:290200 19/24 (79%)
zf-C2H2 368..390 CDD:278523 19/22 (86%)
C2H2 Zn finger 370..390 CDD:275368 17/20 (85%)
mecomXP_017206701.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365266206
eggNOG 1 0.900 E33208_3BAJ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D254483at33208
OrthoFinder 1 1.000 FOG0001415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.