DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and CG17806

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_650658.1	Gene:	CG17806 / 42142	FlyBaseID:	FBgn0038548	Length:	421	Species:	Drosophila melanogaster

Alignment Length:	97	Identity:	35/97 - (36%)
Similarity:	50/97 - (51%)	Gaps:	9/97 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   302 NLPQRNKDR----YTCKFCGKVFPRSANLTRHLRTHTG---EQPYKCKYCERSFSISSNLQRHVR 359
            ||..|.|.|    |.||:|||.|........|.|.|..   .:|:.|..|:::|..|:.|:.|:
  Fly   304 NLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHI- 367

  Fly   360 NIHNKERPFKCEICERCFGQQTNLDRHLK-KH 390
            .:|..|:||.||:|:..|.::..|..|.| ||
  Fly   368 VVHTGEQPFHCELCQTFFNRRNALATHYKSKH 399

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	22/67 (33%)
		zf-C2H2	311..333	CDD:278523	9/21 (43%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	6/26 (23%)
		C2H2 Zn finger	341..362	CDD:275368	6/20 (30%)
		zf-H2C2_2	353..377	CDD:290200	9/23 (39%)
		zf-C2H2	368..390	CDD:278523	8/22 (36%)
		C2H2 Zn finger	370..390	CDD:275368	7/20 (35%)
CG17806	NP_650658.1	zf-AD	4..76	CDD:285071
		zf-C2H2	260..282	CDD:278523
		C2H2 Zn finger	262..282	CDD:275368
		C2H2 Zn finger	290..311	CDD:275368	3/6 (50%)
		COG5048	<298..>383	CDD:227381	29/79 (37%)
		C2H2 Zn finger	319..339	CDD:275368	8/19 (42%)
		C2H2 Zn finger	350..370	CDD:275368	6/20 (30%)
		ZnF_U1	375..407	CDD:197732	11/25 (44%)
		C2H2 Zn finger	378..396	CDD:275368	6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100