DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and CG17806

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:97 Identity:35/97 - (36%)
Similarity:50/97 - (51%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 NLPQRNKDR----YTCKFCGKVFPRSANLTRHLRTHTG---EQPYKCKYCERSFSISSNLQRHVR 359
            ||..|.|.|    |.||:|||.|........|.|.|..   .:|:.|..|:::|..|:.|:.|: 
  Fly   304 NLHVRIKHRGELPYVCKYCGKRFDNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHI- 367

  Fly   360 NIHNKERPFKCEICERCFGQQTNLDRHLK-KH 390
            .:|..|:||.||:|:..|.::..|..|.| ||
  Fly   368 VVHTGEQPFHCELCQTFFNRRNALATHYKSKH 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 22/67 (33%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 6/26 (23%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 8/22 (36%)
C2H2 Zn finger 370..390 CDD:275368 7/20 (35%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071
zf-C2H2 260..282 CDD:278523
C2H2 Zn finger 262..282 CDD:275368
C2H2 Zn finger 290..311 CDD:275368 3/6 (50%)
COG5048 <298..>383 CDD:227381 29/79 (37%)
C2H2 Zn finger 319..339 CDD:275368 8/19 (42%)
C2H2 Zn finger 350..370 CDD:275368 6/20 (30%)
ZnF_U1 375..407 CDD:197732 11/25 (44%)
C2H2 Zn finger 378..396 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.