DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and hb

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_731267.1 Gene:hb FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster

Alignment Length:607 Identity:114/608 (19%)
Similarity:188/608 (31%) Gaps:208/608 (34%)


  Fly    49 SSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKGKRRSSFDQPLDLRLAHKRKTDLVDQGPME 113
            :|.::||..:...:|..|: |...||.|.|.           .||:|...|........||..::
  Fly    38 NSVASSPRQSPIPSTNHLE-QFLKQQQQQLQ-----------QQPMDTLCAMTPSPSQNDQNSLQ 90

  Fly   114 DENSNL-------IMFASELAVAQQKEKELNNNHIAASLADLGFDMSRKMLRALREGGAGGGGGG 171
            ..::||       ..:......|||:..  :::|:..     ||:                    
  Fly    91 HYDANLQQQLLQQQQYQQHFQAAQQQHH--HHHHLMG-----GFN-------------------- 128

  Fly   172 GGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVL-PGKVNSPAASSS-- 233
                          |||||                 .||...::.:.|.| |....:|.::|:  
  Fly   129 --------------PLTPP-----------------GLPNPMQHFYGGNLRPSPQPTPTSASTIA 162

  Fly   234 ----PTGADFPFRHPLKKCELTWPP--------PTEQLQLELPHPNPKLSPVLPHPQLQDYQTRR 286
                .||:.       :|.:...||        |.:..|       ..:.|...|.|:.:.....
  Fly   163 PVAVATGSS-------EKLQALTPPMDVTPPKSPAKSSQ-------SNIEPEKEHDQMSNSSEDM 213

  Fly   287 KNKARTAATGGNATPNLPQRNK----DRYTCKFCGKVFPRSANLTRHLRTHTGEQPYK---CKYC 344
            |..|.:.....|.  .:|..|.    ..|.||.||.|.....:...|.|||.  :|.|   |..|
  Fly   214 KYMAESEDDDTNI--RMPIYNSHGKMKNYKCKTCGVVAITKVDFWAHTRTHM--KPDKILQCPKC 274

  Fly   345 ERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHES-------DAVSLSALSG 402
            ........:|:.|:|. |..::||:|:.|......::.|:.|.|.|.|       |. ..:....
  Fly   275 PFVTEFKHHLEYHIRK-HKNQKPFQCDKCSYTCVNKSMLNSHRKSHSSVYQYRCADC-DYATKYC 337

  Fly   403 VSERMHCIRRFCENP---------TEESYFEEI-------------------------RSFMGKV 433
            .|.::| :|::...|         ...|...::                         :|.:..|
  Fly   338 HSFKLH-LRKYGHKPGMVLDEDGTPNPSLVIDVYGTRRGPKSKNGGPIASGGSGSGSRKSNVAAV 401

  Fly   434 TQQQQQQQQQQQHDQQQQQ---------HQSTATSASSSCSSSRDTPTSSHEEADHAPA-TSTAD 488
            ..||||.|..|.....|..         ..::|..|:|.......:|..|....:..|: .|.|:
  Fly   402 APQQQQSQPAQPVATSQLSAALQGFPLVQGNSAPPAASPVLPLPASPAKSVASVEQTPSLPSPAN 466

  Fly   489 TAAPSSS-------------------------------------RDQEEEDSQPIMELKRTLTSK 516
            ...|.:|                                     |:|.::.:|...:.:......
  Fly   467 LLPPLASLLQQNRNMAFFPYWNLNLQMLAAQQQAAVLAQLSPRMREQLQQQNQQQSDNEEEEQDD 531

  Fly   517 LFPTTTADSAMTTPQTTSIKEE 538
            .:...:.||||...|.|.:||:
  Fly   532 EYERKSVDSAMDLSQGTPVKED 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 20/70 (29%)
zf-C2H2 311..333 CDD:278523 9/22 (41%)
C2H2 Zn finger 313..333 CDD:275368 8/20 (40%)
zf-H2C2_2 325..349 CDD:290200 8/27 (30%)
C2H2 Zn finger 341..362 CDD:275368 5/21 (24%)
zf-H2C2_2 353..377 CDD:290200 8/24 (33%)
zf-C2H2 368..390 CDD:278523 6/22 (27%)
C2H2 Zn finger 370..390 CDD:275368 5/20 (25%)
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 8/20 (40%)
C2H2 Zn finger 271..291 CDD:275368 5/21 (24%)
zf-H2C2_2 283..308 CDD:290200 8/26 (31%)
C2H2 Zn finger 299..319 CDD:275368 5/20 (25%)
C2H2 Zn finger 327..345 CDD:275368 3/20 (15%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24393
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.