DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and CG10654

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster

Alignment Length:163 Identity:39/164 (24%)
Similarity:63/164 (38%) Gaps:56/164 (34%)


  Fly   305 QRNKDRYT--CKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNK--- 364
            :|...|:|  |:.|.:.|.:.:.|..|::.|.|.:||.|.:|.:|::.::.|:.|:|.:||.   
  Fly   218 KRRGVRHTLECRICHRGFYKPSLLEAHMQQHEGLRPYTCVHCAKSYARANLLESHLRQMHNNADA 282

  Fly   365 ----------------ERPFK---------------------CEICERCFGQQTNLDRHLKKHES 392
                            .|..|                     ||.|.:||.::.:|.||...|.|
  Fly   283 ARIIYACPSCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGS 347

  Fly   393 DAVSLSALSGVSERMHCIRRFCENPTEESYFEE 425
                      |..|.:|    ||......|.:|
  Fly   348 ----------VEGRRYC----CECCDRRFYTKE 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 19/60 (32%)
zf-C2H2 311..333 CDD:278523 6/24 (25%)
C2H2 Zn finger 313..333 CDD:275368 5/20 (25%)
zf-H2C2_2 325..349 CDD:290200 9/24 (38%)
C2H2 Zn finger 341..362 CDD:275368 6/21 (29%)
zf-H2C2_2 353..377 CDD:290200 11/64 (17%)
zf-C2H2 368..390 CDD:278523 9/43 (21%)
C2H2 Zn finger 370..390 CDD:275368 8/20 (40%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 5/20 (25%)
C2H2 Zn finger 256..313 CDD:275368 10/57 (18%)
C2H2 Zn finger 289..314 CDD:275368 2/25 (8%)
zf-C2H2 323..345 CDD:278523 8/22 (36%)
C2H2 Zn finger 325..345 CDD:275368 8/20 (40%)
C2H2 Zn finger 355..376 CDD:275368 4/13 (31%)
C2H2 Zn finger 385..405 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5270
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.