DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and CG1602

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_610291.2	Gene:	CG1602 / 35684	FlyBaseID:	FBgn0033186	Length:	577	Species:	Drosophila melanogaster

Alignment Length:	131	Identity:	38/131 - (29%)
Similarity:	66/131 - (50%)	Gaps:	7/131 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            :.|..|.:.|...::|..|:|||||.:||.|::|.::|.:.|.:..||..||.|.|.|||.:|.:
  Fly   423 HKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPK 487

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVS-ERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQ 439
            .|.::.:|..|:|.|.:....:.::.|.. ...|.:.|      ......|::.|:.|:...:..
  Fly   488 DFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIR------HRQIHSEVKKFVCKLCDSRFS 546

  Fly   440 Q 440
            |
  Fly   547 Q 547

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	19/51 (37%)
		zf-C2H2	311..333	CDD:278523	6/21 (29%)
		C2H2 Zn finger	313..333	CDD:275368	6/19 (32%)
		zf-H2C2_2	325..349	CDD:290200	11/23 (48%)
		C2H2 Zn finger	341..362	CDD:275368	6/20 (30%)
		zf-H2C2_2	353..377	CDD:290200	10/23 (43%)
		zf-C2H2	368..390	CDD:278523	8/21 (38%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
CG1602	NP_610291.2	GT1	157..244	CDD:304916
		MADF_DNA_bdg	273..356	CDD:287510
		C2H2 Zn finger	367..388	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		COG5048	<423..554	CDD:227381	38/131 (29%)
		C2H2 Zn finger	425..445	CDD:275368	6/19 (32%)
		zf-H2C2_2	437..460	CDD:290200	11/22 (50%)
		C2H2 Zn finger	453..470	CDD:275368	4/16 (25%)
		C2H2 Zn finger	482..502	CDD:275368	6/19 (32%)
		C2H2 Zn finger	510..530	CDD:275368	3/25 (12%)
		C2H2 Zn finger	538..559	CDD:275368	2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100