DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and CG1602

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_610291.2 Gene:CG1602 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster

Alignment Length:131 Identity:38/132 (29%)
Similarity:66/132 (50%) Gaps:7/132 (5%)


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            :.|..|.:.|...::|..|:|||||.:||.|::|.::|.:.|.:..||..||.|.|.|||.:|.:
  Fly   423 HKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPK 487

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVS-ERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQ 439
            .|.::.:|..|:|.|.:....:.::.|.. ...|.:.|      ......|::.|:.|:...:..
  Fly   488 DFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIR------HRQIHSEVKKFVCKLCDSRFS 546

  Fly   440 Q 440
            |
  Fly   547 Q 547

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 20/52 (38%)
zf-C2H2 311..333 CDD:278523 7/22 (32%)
C2H2 Zn finger 313..333 CDD:275368 7/20 (35%)
zf-H2C2_2 325..349 CDD:290200 12/24 (50%)
C2H2 Zn finger 341..362 CDD:275368 7/21 (33%)
zf-H2C2_2 353..377 CDD:290200 10/24 (42%)
zf-C2H2 368..390 CDD:278523 8/22 (36%)
C2H2 Zn finger 370..390 CDD:275368 6/20 (30%)
CG1602NP_610291.2 GT1 157..244 CDD:304916
MADF_DNA_bdg 273..356 CDD:287510
C2H2 Zn finger 367..388 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
COG5048 <423..554 CDD:227381 38/132 (29%)
C2H2 Zn finger 425..445 CDD:275368 7/20 (35%)
zf-H2C2_2 437..460 CDD:290200 11/23 (48%)
C2H2 Zn finger 453..470 CDD:275368 5/17 (29%)
C2H2 Zn finger 482..502 CDD:275368 6/20 (30%)
C2H2 Zn finger 510..530 CDD:275368 3/26 (12%)
C2H2 Zn finger 538..559 CDD:275368 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24393
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.