DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and zld

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001285466.1 Gene:zld FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster

Alignment Length:688 Identity:136/689 (20%)
Similarity:237/689 (34%) Gaps:235/689 (34%)


  Fly     6 HSPRKMLPSPKQGCVY----------PALGLIPTSYISH--------VPYDLASSASVAATSSSS 52
            :||..:....:||..:          |.:|::|...:.:        :|......:::...||:|
  Fly   914 NSPHTIYRQEQQGTDFSRTTPPPQPLPPMGMLPPMAMDYNMLALDMPMPMPTLMHSNMLQCSSTS 978

  Fly    53 TSPTTTSATTT---------GRLQHQHS------HQ------QHQTLNHHAKGKRRSSFDQPLDL 96
            |:|..|:.||:         .:|.|.:.      ||      |.|..:||.:.:.....||    
  Fly   979 TTPLATTITTSMPDTMQPPQQQLVHHYQAVLHPLHQQLGEQHQRQEADHHQQQRELHQLDQ---- 1039

  Fly    97 RLAHKRKTDLVDQGPMEDEN-------SNLIMFASELAVAQQKEKELNNNHIAASLADLGFDMSR 154
            :...::...|.|..|....:       ..:.|..:.:...|....:....||.:::     .|..
  Fly  1040 QQQQQQALILADSLPHSSSSPTSSSPPPTMPMPLTTITAPQLLPLQPPPPHITSTM-----PMPP 1099

  Fly   155 KMLRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQC--SIPAVHPTLL---------EAMT-- 206
            .|                       ..|..||  ||||  .:..:.||:.         ||.|  
  Fly  1100 TM-----------------------HMPIMPP--PPQCYQQLQPLDPTMSYHTIIGSGPEAHTGT 1139

  Fly   207 --------------KNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKC--------- 248
                          :.|.|...::||...|....|.||..||...|.|..|.|...         
  Fly  1140 AGGGYSNQITTSDGQILQLMPTSLFAPYAPLSPYSVAAQRSPQEGDLPPVHTLTTALHAHQQGGQ 1204

  Fly   249 ---------ELTWP-PPT--------------------------EQLQLELPHPNPKLSPVLPHP 277
                     .|:.| .||                          ||.|::    :.:|..:..|.
  Fly  1205 QEAQTPTLTVLSTPYSPTVSSSRATPALEMDMATLMQHHQDYEMEQYQMQ----HQQLDQMQQHQ 1265

  Fly   278 QLQDYQTRRK---NKARTAA--------TGGNATPNLPQRNKD----------------RYTCKF 315
            |..|:|.:::   ::.:|.|        .||||||:..:|.::                |..|..
  Fly  1266 QQLDHQQQQQILADQTQTMAQQPLAKKRRGGNATPSTTKRRRNSSVGSTSPHSTTLPSGRIKCLE 1330

  Fly   316 CGKVFPRSANLTRHLRT-HTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQ 379
            |.|.|.::..||:|.:: |:||.|::|:.|.:.|........|:.....:::|.|||:|.:.|..
  Fly  1331 CDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCELCPKQFHH 1395

  Fly   380 QTNLDRH-------LKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQ 437
            :|:|.||       ||:|..|.              |.:.||..       :.:|..:       
  Fly  1396 KTDLRRHVEAIHTGLKQHMCDI--------------CEKGFCRK-------DHLRKHL------- 1432

  Fly   438 QQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSHEEADHAPATSTADTAAPSSSRDQEEED 502
                  :.|::.:...:.:|.:|:::.:::..|.|:.   ...|||..:. .||.:.|.......
  Fly  1433 ------ETHNRPRVVGKKSAAAAAAAAAAAAVTATAG---LGGAPAAGSI-KAAFARSLTVTAVS 1487

  Fly   503 SQP---IMELKRTLTSKLFPTTTADSAM---TTPQTTS 534
            |:|   :.......|:...|.:.:.||:   ..|..||
  Fly  1488 SEPGAGVAIPSAPATATCAPVSVSASALVQAVNPSLTS 1525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 19/80 (24%)
zf-C2H2 311..333 CDD:278523 7/23 (30%)
C2H2 Zn finger 313..333 CDD:275368 7/21 (33%)
zf-H2C2_2 325..349 CDD:290200 10/25 (40%)
C2H2 Zn finger 341..362 CDD:275368 4/21 (19%)
zf-H2C2_2 353..377 CDD:290200 6/24 (25%)
zf-C2H2 368..390 CDD:278523 11/29 (38%)
C2H2 Zn finger 370..390 CDD:275368 10/27 (37%)
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 19/61 (31%)
C2H2 Zn finger 1328..1349 CDD:275368 7/21 (33%)
C2H2 Zn finger 1357..1377 CDD:275368 4/20 (20%)
C2H2 Zn finger 1386..1407 CDD:275368 8/21 (38%)
zf-H2C2_2 1398..1422 CDD:290200 8/38 (21%)
zf-C2H2 1413..1435 CDD:278523 6/56 (11%)
C2H2 Zn finger 1415..1435 CDD:275368 5/54 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24393
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.