DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and CG32767

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001162674.1 Gene:CG32767 FlyBaseID:FBgn0052767 Length:1281 Species:Drosophila melanogaster

Alignment Length:708 Identity:136/709 (19%)
Similarity:223/709 (31%) Gaps:232/709 (33%)


  Fly     2 REKDHSPRKMLPSPKQGCVYPALGLIPTSYISHVPYDLASSASVAATSSSSTSPTTTSATTTGR- 65
            :::.|.|...|........:|.......:.:: |....|::|:.|..:|:|.|..::|:.:... 
  Fly    99 QQQHHHPHHHLKLDNSSNNHPPTAAAAAAAVA-VAATTAATAAAATNNSASFSSNSSSSNSNNSN 162

  Fly    66 ---------LQHQHSHQQHQTLNHHAKGKR-------RSSFDQPLDLRLAHKRKTDLVDQGP-ME 113
                     :|.|...|||..||    |:|       .||.....|:     ::.|..::.| :.
  Fly   163 HLDNQQQLLIQQQQQQQQHHLLN----GRRIIIQATGNSSVLAASDI-----KEEDEEEEDPELN 218

  Fly   114 DENSNLIMFASELAVAQQKEKELNNNHIAASL-ADLGFD----------------------MSRK 155
            ||  ||.....|...|:..|:.....|::..: .:|..|                      :..:
  Fly   219 DE--NLQDIEEEAQAAEADEEPETTAHLSTQVKLELEEDDEMPDEEEEEDEDDDEELQHGQLEYQ 281

  Fly   156 MLRALREGGAGGGGGGGGGGGGGGGPPNAPPL--------TPPQCSIPAVHPTLLEAMTKNLPLQ 212
            :..|.:..||......||....|||......|        |..:.|:|.....|::...:  |:.
  Fly   282 ISAATQTAGAATSSAAGGAATAGGGSQQLVQLPAGSIVSTTTHRLSVPVTEAALVQLQRR--PVY 344

  Fly   213 YRNVFAGVLPGK--VNSPAA---SSSPTGADFPFRHPLKKCELTWPPPTEQ------------LQ 260
            ..|...|:..|.  |..|||   |.||.......:..|...:|......:|            |.
  Fly   345 ISNAVGGLTAGATYVRMPAAAVISRSPMTVLNVVQQALPATQLILQTQQQQTPAAAAAEQQLALA 409

  Fly   261 LELPHPNPKLSPVLPHPQLQDYQTRRKNKAR---------------------------------- 291
            ||......:........|.|..:.:|:.:.:                                  
  Fly   410 LEQQRQQQEQQAQQQRQQQQQQEQQRQQQQQQQQQQQQQAQQEQQRQQQQQLQQQQQQQQTHPVK 474

  Fly   292 -----TAATGGNATPNLPQRNKDR----------------------------------------- 310
                 :::|..|:|.|....|.:.                                         
  Fly   475 HSASGSSSTNNNSTTNSTNSNNNTPAATATVTTSYQCVECVEKFDSKELFDIHRSGHANNMKCAI 539

  Fly   311 --------------------YTCKFCGKVFPRSANLTRHLRTHTGEQ----PYKCKYCERSFSIS 351
                                |.|:.||:|.....|..:|:|.|||:|    .|||:.|.:.|...
  Fly   540 CNMVLKSLKNYEKHCLRCKPYECQICGRVVRFRPNFIKHMRVHTGQQSERHKYKCEVCHKEFMSF 604

  Fly   352 SNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMH----CIRR 412
            ...:.| :.|||:.....||||.:.|....:|..|.|.|          |||  ::|    |.:.
  Fly   605 EYFKVH-KKIHNENVNLTCEICGKVFSALASLRGHSKLH----------SGV--KLHKCDVCGKG 656

  Fly   413 FCEN-------PTEESYFE-EIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTAT----SASSSCS 465
            |.:.       .|....|. |.:....|:..|...|...|.|.:.|....:.|.    :|||..|
  Fly   657 FGQRYNLKIHARTHTGDFPFECKICKKKLHTQSSLQTHMQVHLRDQPGAAAAAATAAGAASSKAS 721

  Fly   466 SSRDTPTSSHEEADH------APATSTADTAA-------------PSSSRDQEEEDSQ 504
            :|.::..||:..:.:      :.|.|.|.|..             |.:|.:|:.:.||
  Fly   722 NSSNSSNSSNSSSSNSSSNGVSAAVSAATTTTTIVKLEPPHEIERPGTSSNQQLQQSQ 779

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/128 (18%)
zf-C2H2 311..333 CDD:278523 8/22 (36%)
C2H2 Zn finger 313..333 CDD:275368 7/20 (35%)
zf-H2C2_2 325..349 CDD:290200 12/28 (43%)
C2H2 Zn finger 341..362 CDD:275368 5/21 (24%)
zf-H2C2_2 353..377 CDD:290200 8/24 (33%)
zf-C2H2 368..390 CDD:278523 8/22 (36%)
C2H2 Zn finger 370..390 CDD:275368 8/20 (40%)
CG32767NP_001162674.1 C2H2 Zn finger 537..557 CDD:275368 0/20 (0%)
C2H2 Zn finger 562..582 CDD:275368 7/20 (35%)
C2H2 Zn finger 594..614 CDD:275368 5/21 (24%)
C2H2 Zn finger 622..642 CDD:275368 8/20 (40%)
zf-C2H2 648..670 CDD:278523 4/22 (18%)
C2H2 Zn finger 650..670 CDD:275368 3/20 (15%)
zf-H2C2_2 662..684 CDD:290200 3/22 (14%)
C2H2 Zn finger 678..698 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24393
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.