DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and ZNF367

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_710162.1 Gene:ZNF367 HGNCID:18320 Length:350 Species:Homo sapiens

Alignment Length:318 Identity:84/319 (26%)
Similarity:115/319 (36%) Gaps:57/319 (18%)


  Fly   176 GGGGGPPNAPPLTP--PQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGAD 238
            ||||.|...|||.|  |..|...|:|........|:.|               ||.|:.:...|.
Human    45 GGGGEPEPPPPLIPTSPGFSDFMVYPWRWGENAHNVTL---------------SPGAAGAAASAA 94

  Fly   239 FPFRHPLKKCELTW---PPPTEQLQLEL---PHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGG 297
            .|.....:...|..   |||........   .......||...|  |:|...|.:.:|.|.    
Human    95 LPAAAAAEHSGLRGRGAPPPAASASAAASGGEDEEEASSPDSGH--LKDGIRRGRPRADTV---- 153

  Fly   298 NATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRN 360
            ....|..:.:..|..|..|.:||||..:|..|.||||||:||.|.|  |.::|..|..|:.|.| 
Human   154 RDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQR- 217

  Fly   361 IHNKERPFKCEICERCFGQQTNLDRHLKKH---------ESDAVSLSALSGVSERMHCIRRFCE- 415
            :|..|:||.|.. ..|..:.|:.:||..||         .:|.:|....:........:.|:.| 
Human   218 LHTGEKPFVCSE-NGCLSRFTHANRHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWEM 281

  Fly   416 ----NPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRD 469
                .||          ..||:.|:..|:||......|..:.......|.......|:
Human   282 REQRTPT----------LKGKLVQKADQEQQDPLEYLQSDEEDDEKRGAQRRLQEQRE 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/65 (42%)
zf-C2H2 311..333 CDD:278523 10/22 (45%)
C2H2 Zn finger 313..333 CDD:275368 10/20 (50%)
zf-H2C2_2 325..349 CDD:290200 14/26 (54%)
C2H2 Zn finger 341..362 CDD:275368 8/23 (35%)
zf-H2C2_2 353..377 CDD:290200 9/24 (38%)
zf-C2H2 368..390 CDD:278523 7/22 (32%)
C2H2 Zn finger 370..390 CDD:275368 6/20 (30%)
ZNF367NP_710162.1 COG5048 167..>240 CDD:227381 31/75 (41%)
zf-C2H2 168..189 CDD:278523 10/21 (48%)
C2H2 Zn finger 169..189 CDD:275368 10/20 (50%)
zf-H2C2_2 181..208 CDD:290200 14/27 (52%)
C2H2 Zn finger 197..219 CDD:275368 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5124
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.