DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and egl-43

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001022288.1 Gene:egl-43 WormBaseID:WBGene00001207 Length:543 Species:Caenorhabditis elegans

Alignment Length:468 Identity:110/469 (23%)
Similarity:154/469 (33%) Gaps:217/469 (46%)


  Fly    28 PTSYISHVP--YDLASSASVAATS-------SSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAK 83
            |.::::..|  |.|....:.|:..       :|.:|||||............|..:.:|.:....
 Worm   277 PLAFLAANPEAYKLMQQTTCASPDAECSSGHASESSPTTTEPVDLTATPKPPSTSEMETTSKSDD 341

  Fly    84 GKRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKELNNNHIAASLADL 148
            |:.|.|                :.|.|..:|::|...:..........|::..::     :::|:
 Worm   342 GEDRDS----------------IGDSGNDDDDDSEAGVLDESSTTTSTKKRPTSH-----TISDI 385

  Fly   149 GFDMSRKMLRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQY 213
                                                  |..||....|::.|             
 Worm   386 --------------------------------------LAAPQLGAQALNST------------- 399

  Fly   214 RNVFAGVLPGKVN-SPAASSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHP 277
               |.|:|...:| :||..|                                          ||.
 Worm   400 ---FLGMLQRSLNYNPAVPS------------------------------------------PHS 419

  Fly   278 QLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCK 342
            .|:.....:.:.:.::::|.         .|||||||||.||||||||||||||||||||||||:
 Worm   420 FLRAMSGAKASSSPSSSSGS---------GKDRYTCKFCQKVFPRSANLTRHLRTHTGEQPYKCQ 475

  Fly   343 YCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERM 407
            ||||||||||||||||||||||              ..|:|..|                     
 Worm   476 YCERSFSISSNLQRHVRNIHNK--------------PNTSLTPH--------------------- 505

  Fly   408 HCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPT 472
                                                 .|.:|:..|.||:||.         |.|
 Worm   506 -------------------------------------NHHRQRSLHNSTSTST---------TTT 524

  Fly   473 SSHEEADHAPATS 485
            :.|....|.|.||
 Worm   525 TVHHPLLHLPGTS 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 53/63 (84%)
zf-C2H2 311..333 CDD:278523 21/22 (95%)
C2H2 Zn finger 313..333 CDD:275368 19/20 (95%)
zf-H2C2_2 325..349 CDD:290200 23/24 (96%)
C2H2 Zn finger 341..362 CDD:275368 20/21 (95%)
zf-H2C2_2 353..377 CDD:290200 12/24 (50%)
zf-C2H2 368..390 CDD:278523 3/22 (14%)
C2H2 Zn finger 370..390 CDD:275368 3/20 (15%)
egl-43NP_001022288.1 C2H2 Zn finger 161..181 CDD:275368
zf-C2H2 187..209 CDD:278523
C2H2 Zn finger 189..209 CDD:275368
C2H2 Zn finger 215..232 CDD:275368
zf-C2H2 444..466 CDD:278523 21/22 (95%)
COG5048 446..>502 CDD:227381 51/70 (73%)
C2H2 Zn finger 446..466 CDD:275368 19/20 (95%)
zf-H2C2_2 458..482 CDD:290200 23/24 (96%)
C2H2 Zn finger 474..495 CDD:275368 20/21 (95%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C365263316
eggNOG 1 0.900 E33208_3BAJ6
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001415
OrthoInspector 1 1.000 T375264
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4026
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.