DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and mecom

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017949861.1 Gene:mecom XenbaseID:XB-GENE-980195 Length:179 Species:Xenopus tropicalis

Alignment Length:149 Identity:28/150 (19%)
Similarity:53/150 (35%) Gaps:25/150 (17%)


  Fly   379 QQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQ 443
            ::.|....|:|..:|.....:.|.|:.::...|...::..||..|:...|.:..:.......:.:
 Frog    36 KEPNASAMLEKCSADEYEEGSKSEVNCKVSPSRYDDDDDDEEEDFKTSLSALDHIRHFTDSLKMR 100

  Fly   444 QQHDQQQQQHQSTATSASSSCSSSRDTPTSSHEEADHAPATSTADTAAPSSSRDQEEEDSQPIME 508
            :..|.|....:.:|.             |:||         .|.|...|...:.:.:..:   |.
 Frog   101 KMDDGQFNDGELSAF-------------TASH---------LTDDLKHPLYRKSKSQAYA---MM 140

  Fly   509 LKRTLTSKLFPTTTADSAM 527
            |..:....|.|||...|:|
 Frog   141 LSLSDQESLHPTTHTSSSM 159

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381
zf-C2H2 311..333 CDD:278523
C2H2 Zn finger 313..333 CDD:275368
zf-H2C2_2 325..349 CDD:290200
C2H2 Zn finger 341..362 CDD:275368
zf-H2C2_2 353..377 CDD:290200
zf-C2H2 368..390 CDD:278523 3/11 (27%)
C2H2 Zn finger 370..390 CDD:275368 3/11 (27%)
mecomXP_017949861.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D254483at33208
OrthoFinder 1 1.000 FOG0001415
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.