DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and LOC101731113

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017945455.1 Gene:LOC101731113 ID: Length:516 Species:Xenopus tropicalis

Alignment Length:243 Identity:104/244 (43%)
Similarity:136/244 (56%) Gaps:45/244 (18%)


  Fly   298 NATP-NLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361
            :|.| ||.::.|:||||::|||:||||||||||||||||||||:||||:||||||||||||||||
 Frog   181 SALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNI 245

  Fly   362 HNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEI 426
            ||||:||||.:|:|||||||||||||||||:..:|.:|.|.....:.......:: .|:|||.||
 Frog   246 HNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPHSEIEGTGAILDD-KEDSYFNEI 309

  Fly   427 RSFMGKVTQQQQQQQQQQQ-----HDQQQQQHQST------------------------------ 456
            |:|:|.....:|......:     ||:.....|::                              
 Frog   310 RNFIGNSGHNKQSPLNSDERINGNHDKIMLTGQNSDLLDDDEIEDEAILDEDDEESDIAVKVMKE 374

  Fly   457 --ATSASSSCSSSRDTPTSSHEEADHAPATSTADTAAPSSSRDQEEED 502
              |::....||:      ..:||...:........:......|.||||
 Frog   375 PNASAMLEKCSA------DEYEEGSKSEVNCKVSPSRYDDDDDDEEED 416

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 52/64 (81%)
zf-C2H2 311..333 CDD:278523 19/22 (86%)
C2H2 Zn finger 313..333 CDD:275368 17/20 (85%)
zf-H2C2_2 325..349 CDD:290200 22/24 (92%)
C2H2 Zn finger 341..362 CDD:275368 20/21 (95%)
zf-H2C2_2 353..377 CDD:290200 20/24 (83%)
zf-C2H2 368..390 CDD:278523 19/22 (86%)
C2H2 Zn finger 370..390 CDD:275368 17/20 (85%)
LOC101731113XP_017945455.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D254483at33208
OrthoFinder 1 1.000 FOG0001415
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.