DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10348 and LOC100496511

Sequence 1:NP_001286059.1 Gene:CG10348 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017945236.1 Gene:LOC100496511 ID: Length:684 Species:Xenopus tropicalis

Alignment Length:382 Identity:84/383 (22%)
Similarity:138/383 (36%) Gaps:123/383 (32%)


  Fly   243 HPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNL--PQ 305
            |..|:|:..:|   :...||        ..:|.|.:.::|:..:..||      .|...||  .|
 Frog    75 HECKECDQVFP---DMQSLE--------KHLLSHTEEREYKCDQCPKA------FNWKSNLIRHQ 122

  Fly   306 RNKD---RYTCKFCGK-VFPRSANLTRHLRT-HTGEQPYKCKYCERSFSISSNLQRHVRNIHNKE 365
            .:.|   .|.|:.|.| ||...:||.||:|: |.|.:.:.|..|.::|:.||.|::| ::||:..
 Frog   123 MSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSECGKTFATSSGLKQH-KHIHSSV 186

  Fly   366 RPFKCEICERCFGQQTNLDRHLKKHESDAVSLSA-----LSGVSERMHCIRRFCE---------- 415
            :||.||:|.:.:.|.:||.||.:.|......:..     :...:..::..|||||          
 Frog   187 KPFVCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGL 251

  Fly   416 ------------------------NPTEESYFEEIR---------------SFMG---------- 431
                                    |.....||...|               ||.|          
 Frog   252 FGQGISLPGTPAMDKASMIGINHANAGLADYFGASRHTAGLTFPTAPGFPFSFPGLFPSSLYHRP 316

  Fly   432 ----------KVTQQQQQQQQQQQHDQQQQ-------------QHQSTATSASSSCSSSRDTPTS 473
                      .:...:|.::.|..|..|.|             :|.|...:.:....|..:....
 Frog   317 PLIPAASPVKGLPSVEQSRKSQSPHVNQPQVLPATQDILKALSKHPSIDGNKALEFISDSNVNQR 381

  Fly   474 SHEE-ADHAPATSTADTAAPS-------SSRDQE---EEDSQPIMELKRTLTSKLFP 519
            .||: :||:.::...|.:.||       |..|.|   |.|.:.:.|..:....|:.|
 Frog   382 PHEKVSDHSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKLKENGKLFKGKISP 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/70 (37%)
zf-C2H2 311..333 CDD:278523 11/24 (46%)
C2H2 Zn finger 313..333 CDD:275368 10/22 (45%)
zf-H2C2_2 325..349 CDD:290200 10/25 (40%)
C2H2 Zn finger 341..362 CDD:275368 8/21 (38%)
zf-H2C2_2 353..377 CDD:290200 9/24 (38%)
zf-C2H2 368..390 CDD:278523 9/22 (41%)
C2H2 Zn finger 370..390 CDD:275368 8/20 (40%)
LOC100496511XP_017945236.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D254483at33208
OrthoFinder 1 1.000 FOG0001415
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.