DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31751 and hykk.1

DIOPT Version :8

Sequence 1:NP_001286053.1 Gene:CG31751 / 35118 FlyBaseID:FBgn0086909 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_688090.3 Gene:hykk.1 / 559635 ZFINID:ZDB-GENE-131120-24 Length:355 Species:Danio rerio

Alignment Length:348 Identity:98/349 (28%)
Similarity:176/349 (50%) Gaps:21/349 (6%)


  Fly    63 RPKVEPEDVESLLRRLYGITISEVKEIVAYDDRNFFVKEDSNVKNPLIVTHCPHGYVLKILNSLD 127
            :|.:.......:|:||||:|.|.::.:.:|.|:||:|......:           ||||.:||.|
Zfish     7 KPNLSHSQATDILKRLYGLTTSVIRPLPSYIDQNFYVASSEGGE-----------YVLKAMNSAD 60

  Fly   128 SKKEDFVDAQNQMLLYLGKHSVKCPRPVANATGKYYSVERLN----GNSNVVRLLEFIPGEIFHQ 188
            |:....:..|...:.:|.:..:.....:...||:..|:|.::    ..:.:||||.::||....:
Zfish    61 SQDIAVIKVQTYSMAFLNQRGLPAQIALPTLTGQMMSLEEIDCGFGTQTYLVRLLTYMPGTTICK 125

  Fly   189 VPVTKHLLYRSGEYLARLDRALKNFTH---QAYESHKTLWMLQSVPELRQFLYVVKDQEQRLICD 250
            :.:...:||..|:..|.||..|....|   ...:....:|.|.|:|.|.|:::|:.....:.:..
Zfish   126 ISINTQILYDIGKMAATLDTVLLQMEHPNISVLQRDNFIWSLTSIPLLYQYIHVMDGDPVQKVVK 190

  Fly   251 EVIDAFEAKVLSQLPSMEHQIIHGDFNEQNIVVEQVPNQTEYTIKGVIDFGDTSKSPLIFEIGIA 315
            .||:.::.:|..:||.....|.|||.|::|::|:. ...::|.|.|::||.|.|....|||:.|.
Zfish   191 AVIEQYQVQVRPKLPLFRKCINHGDLNDRNLLVKP-DGPSKYAISGILDFADMSCGYFIFELAIT 254

  Fly   316 LTYMILQA-NDLANGGIFLSGYTSLNPIENSELALLKYCVTARFVQSLVMGLYTHTLHPTN-EYL 378
            :.||:.:: |.|..||..::|:.|:.|:..:|...|.:.:..||.||||:..||....|.| ||:
Zfish   255 IRYMMTESPNPLDVGGPVVAGWESVFPLNEAERDSLYWLILCRFCQSLVIARYTVIQQPENEEYV 319

  Fly   379 LVTQEKGWKLLQKLWRESFDDID 401
            .:..:...:.|.:||....|:::
Zfish   320 RMASKNCVQHLSRLWELGKDEVE 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31751NP_001286053.1 PKc_like 68..350 CDD:304357 80/290 (28%)
hykk.1XP_688090.3 SrkA 8..320 CDD:225213 94/324 (29%)
PKc_like 12..299 CDD:304357 83/299 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257948133
eggNOG 1 0.900 E1_COG2334
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H16057
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1519192at2759
OrthoFinder 1 1.000 FOG0005701
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131687
Panther 1 1.100 O PTHR21064
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.