DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IFT46 and Ift46

Sequence 1:NP_609890.2 Gene:IFT46 FlyBaseID:FBgn0032692 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_076320.2 Gene:Ift46 MGIID:1923818 Length:301 Species:Mus musculus

Alignment Length:354 Identity:98/355 (28%)
Similarity:144/355 (41%) Gaps:126/355 (35%)


  Fly    63 FQNNSTDDDGLLQDIIDHDDEAE-DSEDDDDSEMQLPQGMTMGVGMTGLVPGPNMQKRPGSNRSS 126
            |..|..|||         ||.:| ||:||||.|                                
Mouse    28 FSENDDDDD---------DDSSETDSDDDDDDE-------------------------------- 51

  Fly   127 KQVPDDTLSSGSEEAAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIMSADK 191
                        |..|                       |:.|:...|                .
Mouse    52 ------------EHGA-----------------------PLEGAYDPA----------------D 65

  Fly   192 WEDLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQAP---PLLQPQRQ 253
            :|.|.|..|:||||.||.:||||.||....|:||||:|:|||||:||.|||..|   |       
Mouse    66 YEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKP------- 123

  Fly   254 KDLNDHLEKLGLWLLDEPSGAQSEPSLLNMKLRSVLSGSMGRN-PRHASSASLVPTARSGKDIEK 317
                ||   |||.:|||||..||:|::|::.|   ...|...| .:|....||....::.|.|:.
Mouse   124 ----DH---LGLLVLDEPSTKQSDPTVLSLWL---TENSKQHNITQHMKVKSLEDAEKNPKAIDT 178

  Fly   318 WITEVEQVHMTQ---SMYDVQPRKDIDALLEDWPRSFGDEQTINALDQAYRSCLQQNISVAEYVG 379
            ||..:.::|.::   :::..:|..|||.|:::|...|.:     .|.:.....::.:.|:|||:.
Mouse   179 WIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEE-----LLGKVSLPTVEIDCSLAEYID 238

  Fly   380 VLCERFGVEGPLESQADYIHNVQTLFALY 408
            ::|....:  |.....  |.::..||:||
Mouse   239 MICAILDI--PFYKSR--IQSLHLLFSLY 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IFT46NP_609890.2 IFT46_B_C 189..409 CDD:289115 78/228 (34%)
Ift46NP_076320.2 IFT46_B_C 62..264 CDD:289115 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289289034
eggNOG 1 0.900 E1_2CDGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4751
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006294
OrthoInspector 1 1.000 T1084345
orthoMCL 1 0.900 OOG5_130568
Panther 1 1.100 LDO PTHR13376
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3191
TreeFam 1 0.960
109.780

Return to query results.
Submit another query.