DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IFT46 and ift46

Sequence 1:NP_609890.2 Gene:IFT46 FlyBaseID:FBgn0032692 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001333179.1 Gene:ift46 ZFINID:ZDB-GENE-080102-3 Length:355 Species:Danio rerio

Alignment Length:417 Identity:118/418 (28%)
Similarity:168/418 (40%) Gaps:127/418 (30%)


  Fly     4 YDEEITIGGPD--SKHLSSVQMEPR---NGGTGGGRGGAGGGGPGAVGGEGAVRRAAAGRHRRMF 63
            |||...:...:  |.|..|    ||   :..||..:.....|..|....|...|:.......|..
Zfish    17 YDESFEVNAEEAASVHTPS----PRQIVSRRTGRQKQSTMSGYAGEKLEEDTKRKKEPPPGPRGA 77

  Fly    64 QNNSTDDDGLLQDIIDHDDEAEDSEDDDDSEMQLPQGMTMGVGMTGLVPGPNMQKRPGSNRSSKQ 128
            ..|..::        |.||  :|.:|||||                                   
Zfish    78 NKNDEEE--------DEDD--DDDDDDDDS----------------------------------- 97

  Fly   129 VPDDTLSSGSEEAAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIMSADKWE 193
              |||.|...||.       .|.|..||..|                             || :|
Zfish    98 --DDTESDEEEEE-------PGSAPEGAYDP-----------------------------AD-YE 123

  Fly   194 DLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQAPPLLQPQRQKDLND 258
            .|.|.||:||||.||.:||||||:....|:||||:|:|||||:||.|||..|           :.
Zfish   124 HLPVTGEIKELFQYITRYTPQTIELDHKLKPFIPDFIPAVGDIDAFLKVPRP-----------DG 177

  Fly   259 HLEKLGLWLLDEPSGAQSEPSLLNMKLRSVLSGSMGRNPRHASSASLVPTARSGKDIEKWITEVE 323
            ..:.|||.:||||...||:|::|::.|.   ..|...|.......|:....::.|.||.||..:.
Zfish   178 KPDNLGLLVLDEPCTKQSDPTVLSLWLS---ENSKQHNVTEVKIKSIENPEKNPKAIENWIESIS 239

  Fly   324 QVHMTQ---SMYDVQPRKDIDALLEDWPRSFGDEQTINA--LDQAYRSCLQQNISVAEYVGVLCE 383
            ::|.::   :::..:|..|||:|:::||..|  |:.:..  |..|...|     .:||||.::| 
Zfish   240 ELHRSKPPATVHYTRPMPDIDSLMQEWPSEF--EELLGKVNLPTADIDC-----DLAEYVDMIC- 296

  Fly   384 RFGVEGPLESQA--DYIHNVQTLFALY 408
                 |.|:...  :.||::..||.||
Zfish   297 -----GILDIPVYKNRIHSLHVLFTLY 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IFT46NP_609890.2 IFT46_B_C 189..409 CDD:289115 82/228 (36%)
ift46NP_001333179.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289286830
eggNOG 1 0.900 E1_2CDGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I4621
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006294
OrthoInspector 1 1.000 T1053529
orthoMCL 1 0.900 OOG5_130568
Panther 1 1.100 LDO PTHR13376
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.