DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IFT46 and Ift46

Sequence 1:NP_609890.2 Gene:IFT46 FlyBaseID:FBgn0032692 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_017451042.1 Gene:Ift46 RGDID:1307682 Length:386 Species:Rattus norvegicus

Alignment Length:423 Identity:111/424 (26%)
Similarity:169/424 (40%) Gaps:142/424 (33%)


  Fly     4 YDEEITIGGPDSKHLSSVQMEPRNGGTGGGRGGAGGGGPGAVGGEGA----------VRRAAAGR 58
            |||.:.|.  ||:.::|:. .|..|..|.....|   .|..|..:.:          .::.:...
  Rat    50 YDERLEIN--DSEEVASIS-TPTPGHQGPPFSAA---LPSKVMADNSSDEYEEDNKEKKKPSQLT 108

  Fly    59 HRRMFQNNSTDDDGLLQDIIDHDDEAE-DSEDDDDSEMQLPQGMTMGVGMTGLVPGPNMQKRPGS 122
            .::.|..|..|||         ||.:| ||:||||.|                            
  Rat   109 PQQGFSENDDDDD---------DDSSETDSDDDDDDE---------------------------- 136

  Fly   123 NRSSKQVPDDTLSSGSEEAAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIM 187
                            |..|                       |:.|:...|             
  Rat   137 ----------------EHGA-----------------------PLEGAYDPA------------- 149

  Fly   188 SADKWEDLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQAP---PLLQ 249
               .:|.|.|..|:||||.||.:||||.||....|:||||:|:|||||:||.|||..|   |   
  Rat   150 ---DYEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKP--- 208

  Fly   250 PQRQKDLNDHLEKLGLWLLDEPSGAQSEPSLLNMKLRSVLSGSMGRN-PRHASSASLVPTARSGK 313
                    ||   |||.:|||||..||:|::|::.|   ...|...| .:|....||....::.|
  Rat   209 --------DH---LGLLVLDEPSTKQSDPTVLSLWL---TENSKQHNITQHMKVKSLEDAEKNPK 259

  Fly   314 DIEKWITEVEQVHMTQ---SMYDVQPRKDIDALLEDWPRSFGDEQTINALDQAYRSCLQQNISVA 375
            .|:.||..:.::|.::   :::..:|..|||.|:::|...|.:     .|.:.....::.:.|:|
  Rat   260 AIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEE-----LLGKVSLPTVEIDCSLA 319

  Fly   376 EYVGVLCERFGVEGPLESQADYIHNVQTLFALY 408
            ||:.::|....:  |.....  |.::..||:||
  Rat   320 EYIDMICAILDI--PFYKSR--IQSLHLLFSLY 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IFT46NP_609890.2 IFT46_B_C 189..409 CDD:289115 78/228 (34%)
Ift46XP_017451042.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289286323
eggNOG 1 0.900 E1_2CDGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4635
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006294
OrthoInspector 1 1.000 T1087894
orthoMCL 1 0.900 OOG5_130568
Panther 1 1.100 LDO PTHR13376
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
98.750

Return to query results.
Submit another query.